BYKdb

Annotate results for A0A1A7QC21

A0A1A7QC21 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A7QC21
DOMAINcd69/258TSATPAAGKSFLSANLAASLSRILQVSTFLVDLDLRRGCVAKELGIDFQSGISDYLLGDQ
QNLREVGLSIEGTSLAVFPTRAVSMDSAQAIAGGTYDSLVRTMRDETAGAVIIFDLPPVF
ANDDAVLSTRLLDGYIMVVDSGKTTRRQLTDAMEMLAPVPCLGTVLNRYAGGILDSYGYG
SANYDRYYSE
SITE-210/-212GKT
SITEWalker A'97/104FLVDLDLR
SITEWalker B180/186IIFDLPP
SITEY Cluster245/256YGYGSANYDRYY
SITEWalker A76/78GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDADTAFIGSDQLDIRRLQVVQPRKGAVEANKIVGFNSRDKRSRPFNLMRTQLAKQFIEEKVRLVGITSATPAAGKSFL
                                                                    TSATPAAGKSFL
                                                                           GKS  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SANLAASLSRILQVSTFLVDLDLRRGCVAKELGIDFQSGISDYLLGDQQNLREVGLSIEGTSLAVFPTRAVSMDSAQAIA
SANLAASLSRILQVSTFLVDLDLRRGCVAKELGIDFQSGISDYLLGDQQNLREVGLSIEGTSLAVFPTRAVSMDSAQAIA
                FLVDLDLR                                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGTYDSLVRTMRDETAGAVIIFDLPPVFANDDAVLSTRLLDGYIMVVDSGKTTRRQLTDAMEMLAPVPCLGTVLNRYAGG
GGTYDSLVRTMRDETAGAVIIFDLPPVFANDDAVLSTRLLDGYIMVVDSGKTTRRQLTDAMEMLAPVPCLGTVLNRYAGG
                   IIFDLPP                                                      
       250        
....:....|....:...
ILDSYGYGSANYDRYYSE
ILDSYGYGSANYDRYYSE
    YGYGSANYDRYY  
© 1998-2019