BYKdb

Annotate results for A0A1A7QJ97

A0A1A7QJ97 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A7QJ97
DOMAINcd397/586TSTRPGEGKSTTALALATILSRQGRKVILIDGDMRSPSVHQLAGVDHDRGLSNFLTGEDA
LESLIFKMEDLGVDAMTAGPIPPNAAELLTGNRLSLLVDRLLVTYDHVVVDSPPVLGLAD
APLIGSQLDGVIYAVESHGIRSTQVKTALGRLVSARVKVFGGIVTKFDARKAHFGYDYDY
GYGYGRDAKT
SITEWalker A404/406GKS
SITEWalker A'424/431ILIDGDMR
SITEWalker B504/510VVVDSPP
SITEY Cluster572/580YDYDYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNGRFPAQGRAQRQRVAGEVLLDHVSIEPTRLSRLVDIRFTSPDPAFSASVANAWAENFIESNLERKLQSTSYGRDALQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLTDYKQRLDESQRQLVTYASNQEIINLPATSEGAQERPIVADNLAALNSALSEAIADRIAAESRFRQAGSAGSTAAAL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNTAINNLRQRRAELAADYQQLMVRFEPGYPAAQAIQQQIDALDSAITREESRVSGSVQAEYRQAVQRESALEMRVNSLK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEYLDLRRRSIQYNIFEQEVDTNQALYDGLLQRFEEIGIAGGVGVNNIAIVDLADVPQIPSSPRLVLNLLIALLGGMLLG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAIALGLEQLDESIGDPTELQRRLGLPLLGSVPKVADETPMEALLDRKSELVDAYLAVQTNLGFTTEHGIPRAFSVTSTR
                                                                            TSTR

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGEGKSTTALALATILSRQGRKVILIDGDMRSPSVHQLAGVDHDRGLSNFLTGEDALESLIFKMEDLGVDAMTAGPIPPN
PGEGKSTTALALATILSRQGRKVILIDGDMRSPSVHQLAGVDHDRGLSNFLTGEDALESLIFKMEDLGVDAMTAGPIPPN
   GKS                 ILIDGDMR                                                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAELLTGNRLSLLVDRLLVTYDHVVVDSPPVLGLADAPLIGSQLDGVIYAVESHGIRSTQVKTALGRLVSARVKVFGGIV
AAELLTGNRLSLLVDRLLVTYDHVVVDSPPVLGLADAPLIGSQLDGVIYAVESHGIRSTQVKTALGRLVSARVKVFGGIV
                       VVVDSPP                                                  
       570       580         
....:....|....:....|....:....
TKFDARKAHFGYDYDYGYGYGRDAKTESA
TKFDARKAHFGYDYDYGYGYGRDAKT   
           YDYDYGYGY         
© 1998-2019