BYKdb

Annotate results for A0A1A7T279

A0A1A7T279 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A7T279
DOMAINcd45/227TSTEQEEGKTTLAANLAVVMSETNKKILLIDGDLRRATAGKYFNMRSSQAVGLSTLLNNG
RSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLHELFSELEDQYDAIIVDSPPLLV
VTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKAHLIGVVYNGAKSMGAGNYKY
YKY
SITEWalker A52/54GKT
SITEWalker A'72/79LLIDGDLR
SITEWalker B155/161IIVDSPP
SITEY Cluster222/227YKYYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKVRETRLISIENRFSPITEQYRNVRTSIQFAASAGDPLKLLLVTSTEQEEGKTTLAANLAVVMSETNKKILLIDGDLRR
                                            TSTEQEEGKTTLAANLAVVMSETNKKILLIDGDLRR
                                                   GKT                 LLIDGDLR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAGKYFNMRSSQAVGLSTLLNNGRSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLHELFSELEDQYDAIIVDSP
ATAGKYFNMRSSQAVGLSTLLNNGRSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLHELFSELEDQYDAIIVDSP
                                                                          IIVDSP
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
PLLVVTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKAHLIGVVYNGAKSMGAGNYKYYKY
PLLVVTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKAHLIGVVYNGAKSMGAGNYKYYKY
P                                                            YKYYKY
© 1998-2019