BYKdb

Annotate results for A0A1A9BK55

A0A1A9BK55 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A9BK55
DOMAINcd41/226SSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMSGVFKSRERITGLTEFLSGTT
DLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGS
YRKQKK
SITE-197/-199GKS
SITEWalker A'68/75LLIDADMR
SITEWalker B149/155IVVDTAP
SITE-145/-148YFDY
SITEY Cluster215/221YGFYGSY
SITEWalker A48/50GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEISQAKLELAKKTEEYYNALCTNLQLSGDDLKVFSISSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMS
                                        SSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMS
                                               GKT                 LLIDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSRERITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
GVFKSRERITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
                                                                    IVVDTAP     
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGSYRKQKK
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGSYRKQKK
                                                      YGFYGSY     
© 1998-2019