BYKdb

Annotate results for A0A1A9GA53

A0A1A9GA53 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A9GA53
DOMAINtad21/204SFIDLNRLVTILMRRARLIALSVVVALALGVLYLVFATPLYTAMTQILLDEDLSRYAEEA
ETTPQTSQQADTRLASAIEILKSGRLALRVVDALELSENETILNPPQSPVSLAKGWVKSL
ASLGSDGPAPSAEAEAEGRRQKAAAMLQQALGVERVARSSVVAVSFRSPDPQLSATIAKA
YAAA
DOMAINcd571/765VSALPQEGKSTVAINFAALLAASGKRTLLIDADLRRPSLTAMLKPAPQAGLVEVLLGQAA
WNQAIKVDRRSKLAVLPAGGRAGAGEIHHPNELMASAAMKRLFDELRQTFDYIVVDLAPL
APVVDVKTFEPLADGFLFVVEWGKTPSPLVRDLLSAESRIEAKIVGVVLNKTDMAALPRY
SDFGAAEKYRSLYDQ
SITE-713/-715GKT
SITEWalker A'598/605LLIDADLR
SITEWalker B683/689IVVDLAP
SITEY Cluster759/766YRSLYDQY
SITEWalker A578/580GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHHRTVPYGSLFRREPDASDSFIDLNRLVTILMRRARLIALSVVVALALGVLYLVFATPLYTAMTQILLDEDLSRYAEEA
                    SFIDLNRLVTILMRRARLIALSVVVALALGVLYLVFATPLYTAMTQILLDEDLSRYAEEA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETTPQTSQQADTRLASAIEILKSGRLALRVVDALELSENETILNPPQSPVSLAKGWVKSLASLGSDGPAPSAEAEAEGRR
ETTPQTSQQADTRLASAIEILKSGRLALRVVDALELSENETILNPPQSPVSLAKGWVKSLASLGSDGPAPSAEAEAEGRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKAAAMLQQALGVERVARSSVVAVSFRSPDPQLSATIAKAYAAAFFAEQLDANVHASEQASIWLQERLADIQQRSQAAAL
QKAAAMLQQALGVERVARSSVVAVSFRSPDPQLSATIAKAYAAA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVERYRNENGLTAARGELMSEQQLADLNSQLIVAQADAASASARYNQFRAIVEQGPEKAVANATIPARQGDNAIMQELRG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYNAVVKREEEITRAFSADHPQATALRTEKEDLARQIYQELQQLTASYRNDYDVARSREVSLRENIEKVAGSNAEANRSS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQLRTLEQQAAALKTLSDAYLARYEQATQQQSFPIAKARVISDAGVPTAASSPSRTLTIGLSLVLGLMGGGALTVLQEMR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERAFRVGNDIRAVLGLRPLGYLPLVGARKERAQPARPEDGGTEEGDVIPFERMTRIVLDAPGSAFAETLRHARLASDMML


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGRESRVIGIVSALPQEGKSTVAINFAALLAASGKRTLLIDADLRRPSLTAMLKPAPQAGLVEVLLGQAAWNQAIKVDRR
          VSALPQEGKSTVAINFAALLAASGKRTLLIDADLRRPSLTAMLKPAPQAGLVEVLLGQAAWNQAIKVDRR
                 GKS                 LLIDADLR                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLAVLPAGGRAGAGEIHHPNELMASAAMKRLFDELRQTFDYIVVDLAPLAPVVDVKTFEPLADGFLFVVEWGKTPSPLV
SKLAVLPAGGRAGAGEIHHPNELMASAAMKRLFDELRQTFDYIVVDLAPLAPVVDVKTFEPLADGFLFVVEWGKTPSPLV
                                          IVVDLAP                               
       730       740       750       760       770       780       790 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
RDLLSAESRIEAKIVGVVLNKTDMAALPRYSDFGAAEKYRSLYDQYCTDSVPTVRVRGNDVRAQAGQSRGA
RDLLSAESRIEAKIVGVVLNKTDMAALPRYSDFGAAEKYRSLYDQ                          
                                      YRSLYDQY                         

© 1998-2019