BYKdb

Annotate results for A0A1A9KEF8

A0A1A9KEF8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A9KEF8
DOMAINcd90/265TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLDLPMEKSLNELLAGEA
RLEDVLVNPTLPRFVVLPTREPIPLSTEVLSSPQVSELIGDLRERYDSRIIIFDLPPLLS
SDDAITVLPKFDCVLLVVANGMNSKKEIEDSLYHLANANLIGAVLNKAELQTRTYY
SITEWalker A97/99GKT
SITEWalker A'118/125LLVDFDLR
SITEWalker B200/206IIFDLPP
SITEY Cluster264/265YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRNTPAHDDSQQQSPPAPSHAVSPAVRPDVPGQFDYVQTRVVPLRAEHLERNRIVAYNKNSNMSWTFDLLRTQVLQAME


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLDLPMEKSLNELLAGEARLEDVLVNPTL
         TSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLDLPMEKSLNELLAGEARLEDVLVNPTL
                GKT                  LLVDFDLR                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRFVVLPTREPIPLSTEVLSSPQVSELIGDLRERYDSRIIIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEDS
PRFVVLPTREPIPLSTEVLSSPQVSELIGDLRERYDSRIIIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEDS
                                       IIFDLPP                                  
       250       260     
....:....|....:....|....:
LYHLANANLIGAVLNKAELQTRTYY
LYHLANANLIGAVLNKAELQTRTYY
                       YY
© 1998-2019