BYKdb

Annotate results for A0A1A9N254

A0A1A9N254 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A9N254
DOMAINtad16/275KDIALSDLVALFVDSRRLIALVVTIALMSGMAYAFLSTPMYRADAMIQVDSDAGSSTLND
KLGDLASLFQDKASTDAEIELIRSRKVVEEAVRSLRLDVKATPQRFPLIGALIARHAPPG
VLADPVLGMSRFAWGGERLGVTQFDIPSRLYDKPFKLMVGAENTFDLRDPDGRMVLHGRV
GAMVQGTTPYGPVQLRIEQMTARAGTSFHLTRASTQLTTADLQLALDIGEKAKQSGIVSV
KLDGADAALTAAIVNSVASI
DOMAINcd552/736TGPRPDVGKSFMSVNLSAVLSAGGKRVLLIDSDMRRGDVHEYFALPRKPGLSDVIGGADP
NSAVHRQVLPNLDVLMSGSIASSPAEMLMSDVFGALLAQFSRQYDVVIVDSPPVLAVTDP
VLIGKHAGLTLLVVRHGRHSAAELQESMRQLSSAGRAVDGVLLNDVPQRASTYGAFSEYG
PQKSS
SITEWalker A559/561GKS
SITEWalker A'579/586LLIDSDMR
SITEWalker B658/664VIVDSPP
SITEY Cluster724/730YGAFSEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLLHQELSGQAPGDKDIALSDLVALFVDSRRLIALVVTIALMSGMAYAFLSTPMYRADAMIQVDSDAGSSTLNDKLGDL
               KDIALSDLVALFVDSRRLIALVVTIALMSGMAYAFLSTPMYRADAMIQVDSDAGSSTLNDKLGDL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASLFQDKASTDAEIELIRSRKVVEEAVRSLRLDVKATPQRFPLIGALIARHAPPGVLADPVLGMSRFAWGGERLGVTQFD
ASLFQDKASTDAEIELIRSRKVVEEAVRSLRLDVKATPQRFPLIGALIARHAPPGVLADPVLGMSRFAWGGERLGVTQFD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPSRLYDKPFKLMVGAENTFDLRDPDGRMVLHGRVGAMVQGTTPYGPVQLRIEQMTARAGTSFHLTRASTQLTTADLQLA
IPSRLYDKPFKLMVGAENTFDLRDPDGRMVLHGRVGAMVQGTTPYGPVQLRIEQMTARAGTSFHLTRASTQLTTADLQLA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDIGEKAKQSGIVSVKLDGADAALTAAIVNSVASIYVQRNVDSKSAQAQQMLQFLSEQLPQLRADLDQAEAKYNAFRAEN
LDIGEKAKQSGIVSVKLDGADAALTAAIVNSVASI                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTVDLETEGKLLLQSIVDGKTRVIELQQQRAALAQRYTAEHPSVQAIDRQIGELEQQQNGFNQKVASLPSVQQQALRLMR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVRVDTDLYTKLLDSTQQLRVLKAGQLGNVHTVDYAEVAEKPVRPKKALVIVLSGVIGLMLGCLIAFVRSALNRGLETPS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIESAVGVPVYAIVSRSARQQTLQRSGRSGAAGLNVLAVARPDDVAVEGIRSLRTALQFGLLKSHNNIVMLTGPRPDVGK
                                                                       TGPRPDVGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFMSVNLSAVLSAGGKRVLLIDSDMRRGDVHEYFALPRKPGLSDVIGGADPNSAVHRQVLPNLDVLMSGSIASSPAEMLM
SFMSVNLSAVLSAGGKRVLLIDSDMRRGDVHEYFALPRKPGLSDVIGGADPNSAVHRQVLPNLDVLMSGSIASSPAEMLM
S                 LLIDSDMR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDVFGALLAQFSRQYDVVIVDSPPVLAVTDPVLIGKHAGLTLLVVRHGRHSAAELQESMRQLSSAGRAVDGVLLNDVPQR
SDVFGALLAQFSRQYDVVIVDSPPVLAVTDPVLIGKHAGLTLLVVRHGRHSAAELQESMRQLSSAGRAVDGVLLNDVPQR
                 VIVDSPP                                                        
       730      
....:....|....:.
ASTYGAFSEYGPQKSS
ASTYGAFSEYGPQKSS
   YGAFSEY      

© 1998-2019