BYKdb

Annotate results for A0A1A9NDM5

A0A1A9NDM5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A9NDM5
DOMAINtad16/284RNDGLPGLWRNIARHKLLFAAIFGTCCFMGGLYILLATPQYRADALLRVQNKPGASVSAL
SDVSGTMSADQAADDEGDVLSSRTIVGEAIAQTGADVTVQTESHFPLIGRFLASRHAADT
HLAKPFLGLSSYAWGGEQLKPGIFQVPSAAYGDKFRVVTGEAGSWTLFDKDGRPLAKGQV
GETVPFQVVTDDAGAPAQLRIDVLRARPGVEFTLSAVSMQTAYENVSNQLKTQVSSLNSA
VRDSSLMKLSYQSSSPVTAQLMVNAIVQA
DOMAINcd566/753TGPTQGVGKSFVSSNFAYLLSQTHASVLLIDGDMRQGKLSHLLPDHGGPGLAEVLKGTVA
LDDAIVKQEGSNLSVLGAGNAYPSNPAELLNSPAFADMLATVRECYDFVVIDSPPVLPVS
DAVSIAAQGCDLVLLVSRADHTGSRQLEETLQRLANVGANVGGHIFNGFLPSRYGEHDDY
GLIGARRY
SITEWalker A573/575GKS
SITEWalker A'593/600LLIDGDMR
SITEWalker B674/680VVIDSPP
SITEY Cluster739/745YGEHDDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSFIGQSAMSVPSARNDGLPGLWRNIARHKLLFAAIFGTCCFMGGLYILLATPQYRADALLRVQNKPGASVSALSDVSG
               RNDGLPGLWRNIARHKLLFAAIFGTCCFMGGLYILLATPQYRADALLRVQNKPGASVSALSDVSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMSADQAADDEGDVLSSRTIVGEAIAQTGADVTVQTESHFPLIGRFLASRHAADTHLAKPFLGLSSYAWGGEQLKPGIFQ
TMSADQAADDEGDVLSSRTIVGEAIAQTGADVTVQTESHFPLIGRFLASRHAADTHLAKPFLGLSSYAWGGEQLKPGIFQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPSAAYGDKFRVVTGEAGSWTLFDKDGRPLAKGQVGETVPFQVVTDDAGAPAQLRIDVLRARPGVEFTLSAVSMQTAYEN
VPSAAYGDKFRVVTGEAGSWTLFDKDGRPLAKGQVGETVPFQVVTDDAGAPAQLRIDVLRARPGVEFTLSAVSMQTAYEN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSNQLKTQVSSLNSAVRDSSLMKLSYQSSSPVTAQLMVNAIVQAFVKRNVDDRAAQARLKLETLKTRLPELKKELQTAED
VSNQLKTQVSSLNSAVRDSSLMKLSYQSSSPVTAQLMVNAIVQA                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLSDFRMKNHAIDLEQQGVVLISRMNTLAEKQAALRLEYDEKRQLFGPESPVIKGLVQQLDQVGQDIGQTSDVAKNLPAT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QREYVRLSSDVSVNKQLYTGVLSNVQQLEVAAASTAPGVSVMDWAIAPEKPSWPRKTIVLLGSILGGLFAATVAVHLISL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRKELRTPQEIDYVSDLPRLAVVARSKAQLRDGAQSRGRLASPAKLLAVSSPGDPSVEALRSLPSSVRTLLSGTGGELVN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVILFTGPTQGVGKSFVSSNFAYLLSQTHASVLLIDGDMRQGKLSHLLPDHGGPGLAEVLKGTVALDDAIVKQEGSNLSV
     TGPTQGVGKSFVSSNFAYLLSQTHASVLLIDGDMRQGKLSHLLPDHGGPGLAEVLKGTVALDDAIVKQEGSNLSV
            GKS                 LLIDGDMR                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGAGNAYPSNPAELLNSPAFADMLATVRECYDFVVIDSPPVLPVSDAVSIAAQGCDLVLLVSRADHTGSRQLEETLQRLA
LGAGNAYPSNPAELLNSPAFADMLATVRECYDFVVIDSPPVLPVSDAVSIAAQGCDLVLLVSRADHTGSRQLEETLQRLA
                                 VVIDSPP                                        
       730       740       750   
....:....|....:....|....:....|...
NVGANVGGHIFNGFLPSRYGEHDDYGLIGARRY
NVGANVGGHIFNGFLPSRYGEHDDYGLIGARRY
                  YGEHDDY        

© 1998-2019