BYKdb

Annotate results for A0A1B1AG03

A0A1B1AG03 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B1AG03
DOMAINtad24/197GTFSLKWLFDFLVRRWMLIAAVAAVSFVLAFAVFMIQPPQYSATALVMMSGGGEQVLGPQ
QPNGRPDAPPSAPVVDSQLEVLRSDMLTGRLVDALELMSDPEWNAALEDSDAPAATDQSP
AALAYRTEARQAVVKAVSGAISVRRRGLTYAAEVTAVSQSPERAAQLANHLVEL
DOMAINcd546/730TSALPNEGKTTVSLCLSRVSALSGQRVLLIDCDLRRRSVKEVLDIEPDVGLLQVLSGEVT
WRQAIYLDEASGMCVLPVSGSGFTPKEIFGAEDMSRLIAELRGSFDLIVLDCAPVLAVAE
TRVAAAKADAVVLVSRWQKTPMRAVRAALQQLHDAGANVRGVALNGLDRRAPGYYSYPTY
DFSKG
SITEWalker A553/555GKT
SITEWalker A'573/580LLIDCDLR
SITEWalker B653/659IVLDCAP
SITEY Cluster719/725YYSYPTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNVIAIRKPTGEMNLPPEDGGELGTFSLKWLFDFLVRRWMLIAAVAAVSFVLAFAVFMIQPPQYSATALVMMSGGGEQVL
                       GTFSLKWLFDFLVRRWMLIAAVAAVSFVLAFAVFMIQPPQYSATALVMMSGGGEQVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPQQPNGRPDAPPSAPVVDSQLEVLRSDMLTGRLVDALELMSDPEWNAALEDSDAPAATDQSPAALAYRTEARQAVVKAV
GPQQPNGRPDAPPSAPVVDSQLEVLRSDMLTGRLVDALELMSDPEWNAALEDSDAPAATDQSPAALAYRTEARQAVVKAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGAISVRRRGLTYAAEVTAVSQSPERAAQLANHLVELFQRYQIEARIESAARANTWLSTRLEELRSDVQAKESQVEQYRA
SGAISVRRRGLTYAAEVTAVSQSPERAAQLANHLVEL                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTGLVSTQGAFLIEQQITDAQASLMQARADLSERQARYSQLQDLLNQGGSADTLVTVLNSVVISQLRSQEATVARQLADY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNRYGEAHPAIANVRAELTDIREQIAAETRRIQAGMRNDVDIASARVIQAQAGLDSLRAQMTGGGPEMVRLRELEREAAA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARTVYESFLQRAHEIADQGTINTAPAELISAAAIPSEKSSPRLSISFVLSFALGLGLGLAAAFLAEALDDGFVSSDDVER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTGAPALASIPQVRRSELRQSSTTTTHPAAFMIQRQMSAFTEAFRVLRTTILFAAGQPKTQVVAITSALPNEGKTTVSLC
                                                                 TSALPNEGKTTVSLC
                                                                        GKT     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSRVSALSGQRVLLIDCDLRRRSVKEVLDIEPDVGLLQVLSGEVTWRQAIYLDEASGMCVLPVSGSGFTPKEIFGAEDMS
LSRVSALSGQRVLLIDCDLRRRSVKEVLDIEPDVGLLQVLSGEVTWRQAIYLDEASGMCVLPVSGSGFTPKEIFGAEDMS
            LLIDCDLR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLIAELRGSFDLIVLDCAPVLAVAETRVAAAKADAVVLVSRWQKTPMRAVRAALQQLHDAGANVRGVALNGLDRRAPGYY
RLIAELRGSFDLIVLDCAPVLAVAETRVAAAKADAVVLVSRWQKTPMRAVRAALQQLHDAGANVRGVALNGLDRRAPGYY
            IVLDCAP                                                           YY
       730
....:....|
SYPTYDFSKG
SYPTYDFSKG
SYPTY     

© 1998-2019