BYKdb

Annotate results for A0A1B1CAN5

A0A1B1CAN5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B1CAN5
DOMAINtad22/203DFIDFDKLIAIARRQWRMVAACGFAFAILGIVYVLTSVPVYTADTSVLIDRSDSQVINQL
AAFGQMDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDNPVFTAPKSSLFSISTLKSFVNF
RSWFADDAAVAPDPERKRRSAAETVAGNIDVERVGRSYVLDVSYTAQSPDLARDIAAAIA
DV
DOMAINcd562/752VSSLPGEGKSTTSINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDSRP
LKDLTLLDPKTKLAFLPTVARYRVPHSSELLASRGMDQLLETARQSFDYIIIDLPPLAPV
VDARAINSKLDAVVFVIEWGKTSRKVVQSTLLSEPELYAKCVGTILTKVDPSQMKLYRTF
GSSEYYYKRYS
SITE-701/-703GKT
SITEWalker A'589/596LLIDGDMR
SITEWalker B671/677IIIDLPP
SITEY Cluster746/755YYYKRYSRYY
SITEWalker A569/571GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLSPDKLTPRIDPSRDTGNDADFIDFDKLIAIARRQWRMVAACGFAFAILGIVYVLTSVPVYTADTSVLIDRSDSQVINQ
                     DFIDFDKLIAIARRQWRMVAACGFAFAILGIVYVLTSVPVYTADTSVLIDRSDSQVINQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAFGQMDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDNPVFTAPKSSLFSISTLKSFVNFRSWFADDAAVAPDPERKRR
LAAFGQMDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDNPVFTAPKSSLFSISTLKSFVNFRSWFADDAAVAPDPERKRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAETVAGNIDVERVGRSYVLDVSYTAQSPDLARDIAAAIADVYLVDKLNSKYEATRRAGQWLQERIEELRQQALDTDLA
SAAETVAGNIDVERVGRSYVLDVSYTAQSPDLARDIAAAIADV                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQKFRGEHGLVEAGSGTLISEQQLSEINTQLINAQAETAKAEARYARVKSIIDAKQTDAIVTDVLDSSISNDLRKKYLEA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLETEIEARLGPDHVQAVRLRAEMEEYKRLMFDELNRIAESYQSELQVAKSRENSLRDSVTQATGVAATAGETQVQLRE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LERTRDTYKNLYQSFLTRYQEAIQQQSFPITAARIITTAETPTKPSAPKRALVVAFAMFVGCAFGCGIAAFREFRDRFFR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGDDVRDVLDVESLGVMPLIENNVDDPTLVDPSNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDLSAADQRCKVIG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVSSLPGEGKSTTSINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDSRPLKDLTLLDPKTKLAFLPTV
 VSSLPGEGKSTTSINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDSRPLKDLTLLDPKTKLAFLPTV
        GKS                 LLIDGDMR                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARYRVPHSSELLASRGMDQLLETARQSFDYIIIDLPPLAPVVDARAINSKLDAVVFVIEWGKTSRKVVQSTLLSEPELYA
ARYRVPHSSELLASRGMDQLLETARQSFDYIIIDLPPLAPVVDARAINSKLDAVVFVIEWGKTSRKVVQSTLLSEPELYA
                              IIIDLPP                                           
       730       740       750        
....:....|....:....|....:....|....:...
KCVGTILTKVDPSQMKLYRTFGSSEYYYKRYSRYYTES
KCVGTILTKVDPSQMKLYRTFGSSEYYYKRYS      
                         YYYKRYSRYY   

© 1998-2019