BYKdb

Annotate results for A0A1B1EIK5

A0A1B1EIK5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B1EIK5
DOMAINtad15/198ELIRFGHHYNTLKKNWLSIAAFTLIFSLACTWYIYSKTSIYQATATLLIQEEQKSALSIE
EVYGVDTTKKEYFQTQVAILQSNHIADKVIQGLNLTQYPEFTSTGGLKQTIDNIKSIPLV
QDLLNVTPNPTETAQYSDTYYRALQTFKDKLEIEPVRNTQMVKIRFRSVDPKLATQVANA
VGQA
DOMAINcd545/726TSAIPEEGKTSTSINMAVSFSTMEKVLIIDCDLRQPSLAKRFDIAESQPGLTNILTMDTS
IKDCIVRVEEAKLDVLPAGLIPPNPQELLASARFKKLLDYLQEKYDRIIIDTPPLLSVSD
ALILGQYANGLITVIRAESTKAQLVNVALSKQLQHSVPSLGVLITQAKSKEGEALYVHKY
AY
SITEWalker A552/554GKT
SITEWalker A'571/578LIIDCDLR
SITEWalker B652/658IIIDTPP
SITE-644/-649YLQEKY
SITEY Cluster720/726YVHKYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNGTHPSTFPMNKVELIRFGHHYNTLKKNWLSIAAFTLIFSLACTWYIYSKTSIYQATATLLIQEEQKSALSIEEVYGVD
              ELIRFGHHYNTLKKNWLSIAAFTLIFSLACTWYIYSKTSIYQATATLLIQEEQKSALSIEEVYGVD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTKKEYFQTQVAILQSNHIADKVIQGLNLTQYPEFTSTGGLKQTIDNIKSIPLVQDLLNVTPNPTETAQYSDTYYRALQT
TTKKEYFQTQVAILQSNHIADKVIQGLNLTQYPEFTSTGGLKQTIDNIKSIPLVQDLLNVTPNPTETAQYSDTYYRALQT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FKDKLEIEPVRNTQMVKIRFRSVDPKLATQVANAVGQAYIDTNFEAKLVVTQNAATWLTNNSQKLEERLRDSEQALQDFL
FKDKLEIEPVRNTQMVKIRFRSVDPKLATQVANAVGQA                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQEGLIDINGIDEIYANELEELNRKLNTAVNNRIEAQSLIQLLRRKSSQSLDSLLSIDEFANQVQIRDLKLSEAQAEKNL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SELAQRYGPKHDRMIQAKAQLDSIQTRTQQLIREISFSKQQDLLSAKSQEDMLRAELNRKKTEFQSLGSQKARYEQLKRE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VESNKALYEAFLNREKETSATSDYKNVTARFTDKAIIPLFPVTPQRMKLVLIATVFGFAIACALVIILETLREVIRTASD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEEKLGVTCLGTIPLVKSRRLRKSGLSYTAYLDKNEKLFSEACRSIRTSLLLRLTNAKQKVLPFTSAIPEEGKTSTSINM
                                                                TSAIPEEGKTSTSINM
                                                                       GKT      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVSFSTMEKVLIIDCDLRQPSLAKRFDIAESQPGLTNILTMDTSIKDCIVRVEEAKLDVLPAGLIPPNPQELLASARFKK
AVSFSTMEKVLIIDCDLRQPSLAKRFDIAESQPGLTNILTMDTSIKDCIVRVEEAKLDVLPAGLIPPNPQELLASARFKK
          LIIDCDLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDYLQEKYDRIIIDTPPLLSVSDALILGQYANGLITVIRAESTKAQLVNVALSKQLQHSVPSLGVLITQAKSKEGEALY
LLDYLQEKYDRIIIDTPPLLSVSDALILGQYANGLITVIRAESTKAQLVNVALSKQLQHSVPSLGVLITQAKSKEGEALY
           IIIDTPP                                                             Y
      
....:.
VHKYAY
VHKYAY
VHKYAY

© 1998-2019