BYKdb

Annotate results for A0A1B1FWQ4

A0A1B1FWQ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B1FWQ4
DOMAINtad20/260NDIDFDKLEFVVKKNIIWVILLLILSGVAAYLYIRWTPEIYQANTLNQVKLTSSSQEFAE
KFGITNSSLEEGKLESEMALITSGVMYERIVDSLIDLSVEYYSVGDVRDSELFEDGVPFT
LTYPSGKQPALKNTPFYLQFSNEGKEYVITYKVGQTEKEIKGSSGESIILGGQSLIITPK
NKILETNKYSFTFNSKASIIGFLKRNLSVMIYDPKAKTIQISFTARNRKKAERVLEAINK
A
DOMAINcd606/796TSTISGEGKTFVASNLAGIIAMSDKKVIMVDLDLRKPKVHLAMGGSNTIGASSILVGQNT
IEDCMQETDIPNLKYISAGPIPPNPSELILSNNFKRFIKQLKEKFDVIMLDSPPVGLVTD
GMIVMRHADNPIYVVRADYSKQSFIDNANNLYKSGKFKNISIVLNSVPDRRSYGGYGYGY
GTMTYSSQGYG
SITEWalker A613/615GKT
SITEWalker A'633/640IMVDLDLR
SITEWalker B713/719IMLDSPP
SITE-738/-744YVVRADY
SITEY Cluster778/803YGGYGYGYGTMTYSSQGYGYGYTYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSDFEKEWEDLENNEESSANDIDFDKLEFVVKKNIIWVILLLILSGVAAYLYIRWTPEIYQANTLNQVKLTSSSQEFAEK
                   NDIDFDKLEFVVKKNIIWVILLLILSGVAAYLYIRWTPEIYQANTLNQVKLTSSSQEFAEK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGITNSSLEEGKLESEMALITSGVMYERIVDSLIDLSVEYYSVGDVRDSELFEDGVPFTLTYPSGKQPALKNTPFYLQFS
FGITNSSLEEGKLESEMALITSGVMYERIVDSLIDLSVEYYSVGDVRDSELFEDGVPFTLTYPSGKQPALKNTPFYLQFS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEGKEYVITYKVGQTEKEIKGSSGESIILGGQSLIITPKNKILETNKYSFTFNSKASIIGFLKRNLSVMIYDPKAKTIQI
NEGKEYVITYKVGQTEKEIKGSSGESIILGGQSLIITPKNKILETNKYSFTFNSKASIIGFLKRNLSVMIYDPKAKTIQI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFTARNRKKAERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMSFNKDLSSYMEAGPIVGNI
SFTARNRKKAERVLEAINKA                                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELEKSLNSLKSEKKKYQKLRTLLQADSSIVYIQAYATILTDGSISSSLDELAKLETEALRIRESYTSNTVASNSTLELY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKLRYEVAESIRFAEQFLDENINDLQREISKLRAVFFQNIGGDPDLKKIEKRVSIYTDISDLLTNKLIEVSMAQASTIES


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVIDAPRAGTAPISPRKMIAIAIAIAVGIFLSVLLIVINYLLMDKINGLKHLERRTNMPILGLIPKYEKEEMSVSKLVV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STDPKSTMSEAFRSIRTNLDFMVSDFLDDNPEEEKEQKTSKVISVTSTISGEGKTFVASNLAGIIAMSDKKVIMVDLDLR
                                             TSTISGEGKTFVASNLAGIIAMSDKKVIMVDLDLR
                                                    GKT                 IMVDLDLR
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPKVHLAMGGSNTIGASSILVGQNTIEDCMQETDIPNLKYISAGPIPPNPSELILSNNFKRFIKQLKEKFDVIMLDSPPV
KPKVHLAMGGSNTIGASSILVGQNTIEDCMQETDIPNLKYISAGPIPPNPSELILSNNFKRFIKQLKEKFDVIMLDSPPV
                                                                        IMLDSPP 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVTDGMIVMRHADNPIYVVRADYSKQSFIDNANNLYKSGKFKNISIVLNSVPDRRSYGGYGYGYGTMTYSSQGYGYGYT
GLVTDGMIVMRHADNPIYVVRADYSKQSFIDNANNLYKSGKFKNISIVLNSVPDRRSYGGYGYGYGTMTYSSQGYG    
                                                         YGGYGYGYGTMTYSSQGYGYGYT
       810       820         
....:....|....:....|....:....
YGYDSDLTEEDVAYFDDKKKPFWKKWFKK

YGY                          

© 1998-2019