BYKdb

Annotate results for A0A1B1PNL6

A0A1B1PNL6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B1PNL6
DOMAINcd189/373TSPSKGCGKTFTAANLAISLSRQEGLRAMLMDLDLRNPSLHKAMGVRAPGCMGALLRGAI
SPEAHLMRMGENHIHAGHDIAFGFNEVIEPYAAELLNAPATAEVLTSIEARLQPDVMLFD
LPPALYYDDVLAFRPQIDGVLLVVGGGITTEREIREVERRLGTSTPLLGMVLNKAEGTEL
KKYQY
SITEWalker A196/198GKT
SITEWalker A'217/224MLMDLDLR
SITEWalker B305/311MLFDLPP
SITE-314/-315YY
SITEY Cluster371/373YQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVERRRFRRRKRSEETPEDPPILPLERREERLARRRADRDAEEARAAAQVRVRRQAEEAEREQAERERAAQEQAEREQAE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEAARRELASLRPTAPAASAEQLAPAQTVPPAAEAPARPPRRAVTRRPAPQATLLWDQLPVFEIDSDHLERNRIITANRE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPAHAAFDVLRTRLTQALAENGWTRVGITSPSKGCGKTFTAANLAISLSRQEGLRAMLMDLDLRNPSLHKAMGVRAPGCM
                            TSPSKGCGKTFTAANLAISLSRQEGLRAMLMDLDLRNPSLHKAMGVRAPGCM
                                   GKT                  MLMDLDLR                
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GALLRGAISPEAHLMRMGENHIHAGHDIAFGFNEVIEPYAAELLNAPATAEVLTSIEARLQPDVMLFDLPPALYYDDVLA
GALLRGAISPEAHLMRMGENHIHAGHDIAFGFNEVIEPYAAELLNAPATAEVLTSIEARLQPDVMLFDLPPALYYDDVLA
                                                                MLFDLPP         
       330       340       350       360       370   
....:....|....:....|....:....|....:....|....:....|...
FRPQIDGVLLVVGGGITTEREIREVERRLGTSTPLLGMVLNKAEGTELKKYQY
FRPQIDGVLLVVGGGITTEREIREVERRLGTSTPLLGMVLNKAEGTELKKYQY
                                                  YQY
© 1998-2019