BYKdb

Annotate results for A0A1B1Q171

A0A1B1Q171 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B1Q171
DOMAINtad11/193QEIDIKELLFTLWHNRLVIGAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKSSPAELM
TPFESMTGSQLQNDIELIKSFPLAEEVVRSLYRQTERDSLELFRERRYISPLARFFGAGN
GDEPSVAEKKRKIPLDLKLRSYASRLSSRVTVENGRDTDILYVSVSSPFSHEAALLTNVL
CKT
DOMAINcd598/787SGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPSLHRVFKVDRGPGLTDYLAGQQD
DLKRLTRQVLHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLS
DATVLSRHVDGILMVARMGYTNKNLLRDVQKTEHIRKNILGVAIIGPSVQDKYNYKYGRY
YGRYSYKGYY
SITEWalker A605/607GKS
SITEWalker A'625/632LLLDCDLR
SITEWalker B706/712VILDTPP
SITEY Cluster770/795YNYKYGRYYGRYSYKGYYSRESYQKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPDHNNQFEQEIDIKELLFTLWHNRLVIGAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKSSPAELMTPFESMTGSQ
          QEIDIKELLFTLWHNRLVIGAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKSSPAELMTPFESMTGSQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQNDIELIKSFPLAEEVVRSLYRQTERDSLELFRERRYISPLARFFGAGNGDEPSVAEKKRKIPLDLKLRSYASRLSSRV
LQNDIELIKSFPLAEEVVRSLYRQTERDSLELFRERRYISPLARFFGAGNGDEPSVAEKKRKIPLDLKLRSYASRLSSRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVENGRDTDILYVSVSSPFSHEAALLTNVLCKTYMQKDIEWNADQAMMIKDFVSEQLAVQEKEIAAVESQLSSYMKQENI
TVENGRDTDILYVSVSSPFSHEAALLTNVLCKT                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YELTGNAQNLLNRLVEAESRYNDTRSEINILTKRQEYLVEKLSEEERAISARIAQNVDRQSSELKRRIMEEERTLIEMER


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGNASGEAYDIRKQQLELLRRRLEESTGNIIAGELAFMSKARQYQFDLISEQLQADVRLAELTYVADEYLKSKNYYEAQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKLPQKQLNYARLQRDREVLNNTYTFLRNKLEESRIKIAAESGKVVIVGAGYPPLSPVAPDLKKNVLIGLILGLGLGGAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFVREMLDNSLRDNEFLEQHGYVPLAFIPFIADKARGMQRKQSGKKAKRVGGLIEKLLVQLSPKKEHERLALHTQATADE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLLMNNSLDAGFSESFRDLRTNITFSRADNPLKTIMVSGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPSLHRVF
                                     SGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPSLHRVF
                                            GKS                 LLLDCDLR        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVDRGPGLTDYLAGQQDDLKRLTRQVLHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDAT
KVDRGPGLTDYLAGQQDDLKRLTRQVLHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDAT
                                                                 VILDTPP        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSRHVDGILMVARMGYTNKNLLRDVQKTEHIRKNILGVAIIGPSVQDKYNYKYGRYYGRYSYKGYYSRESYQKYLDTSS
VLSRHVDGILMVARMGYTNKNLLRDVQKTEHIRKNILGVAIIGPSVQDKYNYKYGRYYGRYSYKGYY             
                                                 YNYKYGRYYGRYSYKGYYSRESYQKY     
 
.
T


© 1998-2019