BYKdb

Annotate results for A0A1B1S369

A0A1B1S369 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B1S369
DOMAINcd36/219TSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKIPNTRGLSNVLARQIA
LKMAIQSSGIENLDLLPCGSIPPNPAELLSSPNMDFLFDHALDTYDLLIFDTPPVLSVTD
SVILANKCEGTILVVNSGKTERAQALKAKEAITAAAKIRLLGVVINNVENQQEMGDAAYY
GANE
SITE-173/-175GKT
SITEWalker A'63/70LLIDADMR
SITEWalker B143/149LIFDTPP
SITEY Cluster214/215YY
SITEWalker A43/45GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTITHPKSRVSEQFRTLRTNIHFTSPDGDIRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKI
                                   TSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKI
                                          GKS                 LLIDADMR          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNTRGLSNVLARQIALKMAIQSSGIENLDLLPCGSIPPNPAELLSSPNMDFLFDHALDTYDLLIFDTPPVLSVTDSVILA
PNTRGLSNVLARQIALKMAIQSSGIENLDLLPCGSIPPNPAELLSSPNMDFLFDHALDTYDLLIFDTPPVLSVTDSVILA
                                                              LIFDTPP           
       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
NKCEGTILVVNSGKTERAQALKAKEAITAAAKIRLLGVVINNVENQQEMGDAAYYGANE
NKCEGTILVVNSGKTERAQALKAKEAITAAAKIRLLGVVINNVENQQEMGDAAYYGANE
                                                     YY    
© 1998-2019