BYKdb

Annotate results for A0A1B1S3A4

A0A1B1S3A4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B1S3A4
DOMAINcd51/234TSPAKEEGKSTTAANMAIVFAETGKKVLLVDADMRRPTLFRTFQLGNSTGLSNLLLRKGN
LKHSVKASGIANLDLLMSGQIPPNPAELLESDALDELLEEMRGLYDYVLFDSPPILSVTD
SKILANRCDGTVLVINTGKSEKISVEKARDSLATSKAFIVGVVLNNYPMTNENYYYHNYN
EEMN
SITE-188/-190GKS
SITEWalker A'78/85LLVDADMR
SITEWalker B158/164VLFDSPP
SITE-155/-157YDY
SITEY Cluster224/229YYYHNY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTKNKTKRVMPRKLVVRTNPQSIAAEQYRTIRTNINFSIPELDSKVLLFTSPAKEEGKSTTAANMAIVFAETGKKVLLV
                                                  TSPAKEEGKSTTAANMAIVFAETGKKVLLV
                                                         GKS                 LLV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRRPTLFRTFQLGNSTGLSNLLLRKGNLKHSVKASGIANLDLLMSGQIPPNPAELLESDALDELLEEMRGLYDYVLF
DADMRRPTLFRTFQLGNSTGLSNLLLRKGNLKHSVKASGIANLDLLMSGQIPPNPAELLESDALDELLEEMRGLYDYVLF
DADMR                                                                        VLF
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DSPPILSVTDSKILANRCDGTVLVINTGKSEKISVEKARDSLATSKAFIVGVVLNNYPMTNENYYYHNYNEEMN
DSPPILSVTDSKILANRCDGTVLVINTGKSEKISVEKARDSLATSKAFIVGVVLNNYPMTNENYYYHNYNEEMN
DSPP                                                           YYYHNY     
© 1998-2019