BYKdb

Annotate results for A0A1B1UCM8

A0A1B1UCM8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B1UCM8
DOMAINcd92/271TSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGIDGNGGVLDVLEGRT
PLSSAVLQASIGPNNMLVLPGSVSSNSSEWMASQTMGALLQTIKRDFRSRIVIFDLPPML
LGDDVISILPRMDAALLVAGVGSTTVSDIKECQRHLRRTTVVRVVVNKSTEAAGSYYGYY
SITEWalker A99/101GKT
SITEWalker A'120/127LLVDLDLR
SITEWalker B203/209VIFDLPP
SITEY Cluster267/271YYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDSIKQAVELARAAEVVHRPGVLSGSALAANGPLQRSAESPINEVRLRADHLEANRIVAYGTSGPNGRYYDMLRTQVLQE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGIDGNGGVLDVLEGRTPLSSAVLQA
           TSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGIDGNGGVLDVLEGRTPLSSAVLQA
                  GKT                  LLVDLDLR                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIGPNNMLVLPGSVSSNSSEWMASQTMGALLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRMDAALLVAGVGSTTVSDI
SIGPNNMLVLPGSVSSNSSEWMASQTMGALLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRMDAALLVAGVGSTTVSDI
                                          VIFDLPP                               
       250       260       270 
....:....|....:....|....:....|.
KECQRHLRRTTVVRVVVNKSTEAAGSYYGYY
KECQRHLRRTTVVRVVVNKSTEAAGSYYGYY
                          YYGYY
© 1998-2019