BYKdb

Annotate results for A0A1B1Z952

A0A1B1Z952 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B1Z952
DOMAINcd50/227TSPKPGEGKSTTVANLAIAFAQQGKKVLLIDADLRKPTVANTFSLPNTSGLTNVLSRQSK
IEQVIQQTAVENLHILTSGPIPPNPSELLGSNSMKELVAKAENEFDIILFDSPPVLAVTD
AQVLTNLSDGTILVVRSGSTDQDAAKKAKDLLQVGKSRLLGVVLNGKNQKQEQYYYYY
SITE-204/-206GKS
SITEWalker A'77/84LLIDADLR
SITEWalker B157/163ILFDSPP
SITEY Cluster223/227YYYYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKSKKKLNNQRLLVADLNSKSPVFESYRTLRTNIQFASVDQDIKKIVITSPKPGEGKSTTVANLAIAFAQQGKKVLLID
                                                 TSPKPGEGKSTTVANLAIAFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPTVANTFSLPNTSGLTNVLSRQSKIEQVIQQTAVENLHILTSGPIPPNPSELLGSNSMKELVAKAENEFDIILFD
ADLRKPTVANTFSLPNTSGLTNVLSRQSKIEQVIQQTAVENLHILTSGPIPPNPSELLGSNSMKELVAKAENEFDIILFD
ADLR                                                                        ILFD
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
SPPVLAVTDAQVLTNLSDGTILVVRSGSTDQDAAKKAKDLLQVGKSRLLGVVLNGKNQKQEQYYYYY
SPPVLAVTDAQVLTNLSDGTILVVRSGSTDQDAAKKAKDLLQVGKSRLLGVVLNGKNQKQEQYYYYY
SPP                                                           YYYYY
© 1998-2019