BYKdb

Annotate results for A0A1B2A5M0

A0A1B2A5M0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B2A5M0
DOMAINcd57/242TSAGPSQGKSTVSANVAVTWADQGVDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETF
DLNSAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTKHFDLVIFDVPPVVSVT
DAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGY
YGTEDK
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B165/171VIFDVPP
SITEY Cluster232/237YYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFRKEKGLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
                                                        TSAGPSQGKSTVSANVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNSAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNSAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
   LLVDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGTE
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGTE
    VIFDVPP                                                            YYGGYY   
  
..
DK
DK

© 1998-2019