BYKdb

Annotate results for A0A1B2DHX8

A0A1B2DHX8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B2DHX8
DOMAINcd46/225TSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMRKPTQHQLFRVSNQIGLTSVLSNQKE
WENAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPIMVVTD
AQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
SITEWalker A53/55GKS
SITEWalker A'73/80LLIDADMR
SITEWalker B153/159IIVDTPP
SITEY Cluster220/224YLYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRTKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
                                             TSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
                                                    GKS                 LLIDADMR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTQHQLFRVSNQIGLTSVLSNQKEWENAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
KPTQHQLFRVSNQIGLTSVLSNQKEWENAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
                                                                        IIVDTPP 
       170       180       190       200       210       220     
....:....|....:....|....:....|....:....|....:....|....:....|....:
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
                                                           YLYYY 
© 1998-2019