BYKdb

Annotate results for A0A1B2EQN1

A0A1B2EQN1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B2EQN1
DOMAINcd88/264TSPTVGCGKTVVGLNLAFSFASLLDCRTVLVDLDLRQPKVADVLGMGQLSSIEDFLVRDA
PIECVFARFGENLAIGANRGYIAHAAELLHGPGIRRRMTEMKEQLRPDLILFDLPPMLAT
DDVLAFLPNVDCAILVAAAEVSTISEIDVCEHTLREETNLLGVVLNKCRFDPRKYGY
SITEWalker A95/97GKT
SITEWalker A'116/123VLVDLDLR
SITEWalker B197/203ILFDLPP
SITEY Cluster262/264YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQIHDVLLNSENETSVTFAESRASSFPPDENLTWMRLRQMKVDESRAADERIVTITRTNPAHFPFDILRTKMLRIMREN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KWTSVAITSPTVGCGKTVVGLNLAFSFASLLDCRTVLVDLDLRQPKVADVLGMGQLSSIEDFLVRDAPIECVFARFGENL
       TSPTVGCGKTVVGLNLAFSFASLLDCRTVLVDLDLRQPKVADVLGMGQLSSIEDFLVRDAPIECVFARFGENL
              GKT                  VLVDLDLR                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGANRGYIAHAAELLHGPGIRRRMTEMKEQLRPDLILFDLPPMLATDDVLAFLPNVDCAILVAAAEVSTISEIDVCEHT
AIGANRGYIAHAAELLHGPGIRRRMTEMKEQLRPDLILFDLPPMLATDDVLAFLPNVDCAILVAAAEVSTISEIDVCEHT
                                    ILFDLPP                                     
       250       260    
....:....|....:....|....
LREETNLLGVVLNKCRFDPRKYGY
LREETNLLGVVLNKCRFDPRKYGY
                     YGY
© 1998-2019