BYKdb

Annotate results for A0A1B3E0T4

A0A1B3E0T4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B3E0T4
DOMAINtad22/211DEIDLLKLWQTLWLRKWSILTLVAVVTMAAILAVLAITPIYRAAATLMIEEKTAKVVSIE
QVYGLEGAGSEYLQTQFELLKSRALAERVVRQLNLTTHPEFDPRQQPEPLIDIGGLLAHL
DFNKVVPVTLPGDLEDEQDPTEAQIFDSVTKAFMERISVEPQGKSQLVKVQVDMADARMA
ALAANALANG
DOMAINcd555/744TSSIPGEGKSTVSANLAFALGQMERVLLIDADLRRPTLAKNFDFPVGTPGLANLIASTAK
LDECIKHVDGIDMMSAGSVPPNPLELLSSPRFAKAIELLKSKYDRIVIDSPPTQAVSDAI
VLSTFANSLIYVVKSASTAIPLVEKGVGQLLQSNAPVNGIVLNQVDIKKAKKYGYSYGGY
YDYYGYSDAK
SITEWalker A562/564GKS
SITEWalker A'581/588LLIDADLR
SITEWalker B660/666IVIDSPP
SITEY Cluster727/740YGYSYGGYYDYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESNTPIIERNLIAQRQDEDDDEIDLLKLWQTLWLRKWSILTLVAVVTMAAILAVLAITPIYRAAATLMIEEKTAKVVSI
                     DEIDLLKLWQTLWLRKWSILTLVAVVTMAAILAVLAITPIYRAAATLMIEEKTAKVVSI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQVYGLEGAGSEYLQTQFELLKSRALAERVVRQLNLTTHPEFDPRQQPEPLIDIGGLLAHLDFNKVVPVTLPGDLEDEQD
EQVYGLEGAGSEYLQTQFELLKSRALAERVVRQLNLTTHPEFDPRQQPEPLIDIGGLLAHLDFNKVVPVTLPGDLEDEQD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTEAQIFDSVTKAFMERISVEPQGKSQLVKVQVDMADARMAALAANALANGFIEGQLEATMEMSMTATNWMNSRLGDLRT
PTEAQIFDSVTKAFMERISVEPQGKSQLVKVQVDMADARMAALAANALANG                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLKEAEDRLQAFREAENLVDVDGVATISAAELNLTGDRMIDARRQRAEAESQYRQVQAMRSGGWERLASIPAVLGHPLIQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFKAEEAKAKAKVEELSRRYGARHPAMEAARSELSAASASLRGQVEQVVAGIERNYQLAAANENSLQASFNANKSQIQDI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRKEFKLRELQREVDANRALYDTFMTRLKETAATSDLESANARVVDKAAVPTEPIKPKKALIVAIAALLALFVGVGLTLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDALNNTFKSTEQVEARLNIPVLGILPLLKNQERSQLAHMFSADKDKSFSESIRTIRTGVVLSGIDDPHKVMVITSSIPG
                                                                          TSSIPG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGKSTVSANLAFALGQMERVLLIDADLRRPTLAKNFDFPVGTPGLANLIASTAKLDECIKHVDGIDMMSAGSVPPNPLEL
EGKSTVSANLAFALGQMERVLLIDADLRRPTLAKNFDFPVGTPGLANLIASTAKLDECIKHVDGIDMMSAGSVPPNPLEL
 GKS                LLIDADLR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSPRFAKAIELLKSKYDRIVIDSPPTQAVSDAIVLSTFANSLIYVVKSASTAIPLVEKGVGQLLQSNAPVNGIVLNQVD
LSSPRFAKAIELLKSKYDRIVIDSPPTQAVSDAIVLSTFANSLIYVVKSASTAIPLVEKGVGQLLQSNAPVNGIVLNQVD
                   IVIDSPP                                                      
       730       740      
....:....|....:....|....:.
IKKAKKYGYSYGGYYDYYGYSDAKQA
IKKAKKYGYSYGGYYDYYGYSDAK  
      YGYSYGGYYDYYGY      

© 1998-2019