BYKdb

Annotate results for A0A1B3MUP0

A0A1B3MUP0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B3MUP0
DOMAINtad22/190MTAAARRGWLVLRRHRVILFVTMALCLLAGVLAILMSTPDYRATASVEVEDVPAGAAGAD
ATPRAATDNIEAMMQTELEVLRSRALAEAVAQDLALVGTPTFLKGMGHRRPTGGTGSLSQ
RQVEQEQVVALLRDNLEVELPGKSRVLRISFVSADPVLSARVANSYADN
DOMAINcd517/696TSAQEGEGKSLTLHALALALGRMGKRVLVIDGDMRRPVQHSLFRVTPARGISEVLTGQAT
AQESIIDSGVPGVFLLPCGAVPPNPAELLATPALDALLDSVRDAYDTVLIDAPPILGLGD
TPLLAARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
SITEWalker A524/526GKS
SITEWalker A'544/551LVIDGDMR
SITEWalker B624/630VLIDAPP
SITEY Cluster690/692YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPILTNRDLDATPGHGRAARMTAAARRGWLVLRRHRVILFVTMALCLLAGVLAILMSTPDYRATASVEVEDVPAGAAGA
                     MTAAARRGWLVLRRHRVILFVTMALCLLAGVLAILMSTPDYRATASVEVEDVPAGAAGA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DATPRAATDNIEAMMQTELEVLRSRALAEAVAQDLALVGTPTFLKGMGHRRPTGGTGSLSQRQVEQEQVVALLRDNLEVE
DATPRAATDNIEAMMQTELEVLRSRALAEAVAQDLALVGTPTFLKGMGHRRPTGGTGSLSQRQVEQEQVVALLRDNLEVE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPGKSRVLRISFVSADPVLSARVANSYADNLIRADLKRGFESGVQARRFLLGELDGARRDLARAERELAVYAARLGMEPG
LPGKSRVLRISFVSADPVLSARVANSYADN                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KDAPPSEDSITTRLAQLNAFRAQALADRIAAQKTWEGARRASVETLPEVLNNGAMQTLMAERAKARAALVEERQFRKDAH


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PEMREARARLAALDDQAQEMANRIRASLKERYDVAVHGETQITAEIADLERQGQAAQGRDVQLGIYERSVDTYRMLHDSL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRYRDMASQAGFQAGRIQPLDRAAVPTKPFSPRIGVTLLLAAIGGILLGLLLVAARHIFDDAVTSADTLAERVGLPLLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVPVTGDNPQPPEIFAPIASSLLLASAAGLPRSILVTSAQEGEGKSLTLHALALALGRMGKRVLVIDGDMRRPVQHSLFR
                                    TSAQEGEGKSLTLHALALALGRMGKRVLVIDGDMRRPVQHSLFR
                                           GKS                 LVIDGDMR         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTPARGISEVLTGQATAQESIIDSGVPGVFLLPCGAVPPNPAELLATPALDALLDSVRDAYDTVLIDAPPILGLGDTPLL
VTPARGISEVLTGQATAQESIIDSGVPGVFLLPCGAVPPNPAELLATPALDALLDSVRDAYDTVLIDAPPILGLGDTPLL
                                                               VLIDAPP          
       650       660       670       680       690      
....:....|....:....|....:....|....:....|....:....|....:.
AARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
AARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
                                                 YDY    
© 1998-2019