BYKdb

Annotate results for A0A1B3P4U6

A0A1B3P4U6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B3P4U6
DOMAINtad3/176QEIDLKSIIGLFRRQLWLMVSIVIAIVILTGGVLYTLTPKYTATNKVMVDLSNKDLLQPD
ERMNVSVSDANARVESEVAILRSDNIYLEVVRRENLLSDPEFGVQPGRFDWIKSYLNLNS
GTAPSGEFLLGQTLSRLQSAVSVRRQGLTYIIEISVTSREPAKSARLANAIASA
DOMAINcd522/715TSTEPNEGKSTTALALARTLARSGKKTLIIDCDLRKPSLSKLTGVNAAPWLSEVLRGQEL
PPSVSKQALTDPLSDLSMIFGSRVSDIATDDLLMGDRFNQILRTARRHFDYIVIDTPPVG
AVVDALYLARFTDMVVFVLKWASTPQTMAKKALAALKEQSGPETKHVLVLNQKEKPSGGK
YSSYAAYYGQSEGD
SITEWalker A529/531GKS
SITEWalker A'549/556LIIDCDLR
SITEWalker B633/639IVIDTPP
SITEY Cluster702/709YSSYAAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQEIDLKSIIGLFRRQLWLMVSIVIAIVILTGGVLYTLTPKYTATNKVMVDLSNKDLLQPDERMNVSVSDANARVESEV
  QEIDLKSIIGLFRRQLWLMVSIVIAIVILTGGVLYTLTPKYTATNKVMVDLSNKDLLQPDERMNVSVSDANARVESEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AILRSDNIYLEVVRRENLLSDPEFGVQPGRFDWIKSYLNLNSGTAPSGEFLLGQTLSRLQSAVSVRRQGLTYIIEISVTS
AILRSDNIYLEVVRRENLLSDPEFGVQPGRFDWIKSYLNLNSGTAPSGEFLLGQTLSRLQSAVSVRRQGLTYIIEISVTS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REPAKSARLANAIASAYIDLQLQSKISRTVSSRNIIQAQISQANNSLIESERGFDRYLSENLDRIEQESASPRIAQLRSE
REPAKSARLANAIASA                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FERIRTERERVSGLAQVVELSLNAGDISALTANLQADAIRQLQERQQEVNAALGQVADGSQRALNLRSELEQIQAQIVEE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGRELTKLQQEVASYDNRGDTVRTEMRTAMLNSNLPPEVLTEIYSLQQSSEIARNQYQSLLQRLQELDVQAQLQVADARI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNEASAPTSASFPNKRLILAIAAVFALGLGGAIAVLRELFIGGFTSEEQVEQVLRTPLATTIPRQTGSSNLMKIGVADMV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSAPLSVFSESIRRLRVLVERRKADLVKDSSDEKSGLVIMVTSTEPNEGKSTTALALARTLARSGKKTLIIDCDLRKPSL
                                         TSTEPNEGKSTTALALARTLARSGKKTLIIDCDLRKPSL
                                                GKS                 LIIDCDLR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKLTGVNAAPWLSEVLRGQELPPSVSKQALTDPLSDLSMIFGSRVSDIATDDLLMGDRFNQILRTARRHFDYIVIDTPPV
SKLTGVNAAPWLSEVLRGQELPPSVSKQALTDPLSDLSMIFGSRVSDIATDDLLMGDRFNQILRTARRHFDYIVIDTPPV
                                                                        IVIDTPP 
       650       660       670       680       690       700       710     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
GAVVDALYLARFTDMVVFVLKWASTPQTMAKKALAALKEQSGPETKHVLVLNQKEKPSGGKYSSYAAYYGQSEGD
GAVVDALYLARFTDMVVFVLKWASTPQTMAKKALAALKEQSGPETKHVLVLNQKEKPSGGKYSSYAAYYGQSEGD
                                                             YSSYAAYY      

© 1998-2019