BYKdb

Annotate results for A0A1B3PZG7

A0A1B3PZG7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B3PZG7
DOMAINtad1/135MTIVDVVRILRRNLALLIVCTLAGGLLGAVYQLTRPETFTAKATGMVVAGDSTSVGETMS
GNTIAQQRAATYTKLVETRTMAQKTSEILKKQGMPEAANGQLSASVPGDTAFIDIKATGD
TAKNAQALANAGLEA
DOMAINcd279/468TSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKAFGAEAGVGLSQVLAGDVT
LDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAVTD
AGLLGAIADGTIYVAVVGKTHRDQVSLVAKRLQQVGAPLLGSVLTRVPRKKMGDVLYGYG
AANYGYGSYY
SITE-416/-418GKT
SITEWalker A'306/313VLIDADMR
SITEWalker B386/392VVIDAPP
SITEY Cluster455/476YGYGAANYGYGSYYGDYGKRGY
SITEWalker A286/288GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIVDVVRILRRNLALLIVCTLAGGLLGAVYQLTRPETFTAKATGMVVAGDSTSVGETMSGNTIAQQRAATYTKLVETRT
MTIVDVVRILRRNLALLIVCTLAGGLLGAVYQLTRPETFTAKATGMVVAGDSTSVGETMSGNTIAQQRAATYTKLVETRT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAQKTSEILKKQGMPEAANGQLSASVPGDTAFIDIKATGDTAKNAQALANAGLEALISEALRMETYGQIAASDHKSDAQL
MAQKTSEILKKQGMPEAANGQLSASVPGDTAFIDIKATGDTAKNAQALANAGLEA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKMTSVHVLGYESAGLPSGDRGKSVALYVVAGLVAGFLIGAVVAVVRKQFDVKVRDQATIEELTGSGILSVIPDDKKLAE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QREKSIVHISGVTGEAFRHLRTNLRFANVDNPPRAVVVTSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
                                      TSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
                                             GKS                 VLIDADMR       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGAEAGVGLSQVLAGDVTLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAVTDAG
FGAEAGVGLSQVLAGDVTLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAVTDAG
                                                                 VVIDAPP        
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGAIADGTIYVAVVGKTHRDQVSLVAKRLQQVGAPLLGSVLTRVPRKKMGDVLYGYGAANYGYGSYYGDYGKRGYSSYS
LLGAIADGTIYVAVVGKTHRDQVSLVAKRLQQVGAPLLGSVLTRVPRKKMGDVLYGYGAANYGYGSYY            
                                                      YGYGAANYGYGSYYGDYGKRGY    
       490       500       510       520   
....:....|....:....|....:....|....:....|...
SEEQDSRESIAVVQEAQSTEGLVRVPKKDRADTDTEITPRRAK


© 1998-2019