BYKdb

Annotate results for A0A1B3Z8Q1

A0A1B3Z8Q1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B3Z8Q1
DOMAINtad39/210ASNGLQNFIAVVLKRRWLILGITLAALVIALLFTVFSPPVYIARATFQVQREAPRVVDTQ
GANAASNTENDQAFLNTQFALMTSRVTAQGIVRRLNLATNRDFIGSGTFGGVFQNDSAPS
PAALQQAFDAATAKVMQNLTATQYGTSLLIQVQYEDRNPAMAASIANAAIDE
DOMAINcd552/742TSSNPNEGKTTTAISLAQSFAQEGKRVLLVDADMRRPSLHKMLGFNNAEGFANALNGERR
AADVIVHDGHGYDVLPSGPISPNPARLLSGGLRGLLADLESRYDMVIFDGPPIVGLADVP
ILSAAIEETILVIQARKSRRRVVMSALRRLRSSRSSIVGVILTKFDHRSADYAYTYAYSS
YYYSYGDNRTA
SITEWalker A559/561GKT
SITEWalker A'579/586LLVDADMR
SITEWalker B657/663VIFDGPP
SITEY Cluster723/736YAYTYAYSSYYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTERTTSIEPAPGDVWQDDGARGAAARPWQSIGGVGAGASNGLQNFIAVVLKRRWLILGITLAALVIALLFTVFSPPVYI
                                      ASNGLQNFIAVVLKRRWLILGITLAALVIALLFTVFSPPVYI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARATFQVQREAPRVVDTQGANAASNTENDQAFLNTQFALMTSRVTAQGIVRRLNLATNRDFIGSGTFGGVFQNDSAPSPA
ARATFQVQREAPRVVDTQGANAASNTENDQAFLNTQFALMTSRVTAQGIVRRLNLATNRDFIGSGTFGGVFQNDSAPSPA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALQQAFDAATAKVMQNLTATQYGTSLLIQVQYEDRNPAMAASIANAAIDEFIQDSIERQFLSSKYAGDFVGRRLLELKAK
ALQQAFDAATAKVMQNLTATQYGTSLLIQVQYEDRNPAMAASIANAAIDE                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEKSERDLVDYASHEKIISVTDAGKPGAQAQSLDSASLNVINNAAVTAKAQRLDAEAAWQLAQTSSAGALAQSTNDPQIN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLAGKLATLQADYQQKAQTFRPNFPAMVELRAQIGAIQKQIDQQRGKLLQVVKGNYQLALDKEKALDDQLAKATSQVLDV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSRSIQYMILQREVDTNRALYDALLSRYKEIGVSGGSNSNNVSIIDRARAPGSPAWPILWLNLLIALVGGLAIGLGVAFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDFLDDTFKMPEDVETNLGLPLLGMIPKLDEDETPLGELAKARSSFVEAYFAARTALQLAGANGAPKSLLITSSNPNEGK
                                                                       TSSNPNEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTTAISLAQSFAQEGKRVLLVDADMRRPSLHKMLGFNNAEGFANALNGERRAADVIVHDGHGYDVLPSGPISPNPARLLS
TTTAISLAQSFAQEGKRVLLVDADMRRPSLHKMLGFNNAEGFANALNGERRAADVIVHDGHGYDVLPSGPISPNPARLLS
T                 LLVDADMR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGLRGLLADLESRYDMVIFDGPPIVGLADVPILSAAIEETILVIQARKSRRRVVMSALRRLRSSRSSIVGVILTKFDHRS
GGLRGLLADLESRYDMVIFDGPPIVGLADVPILSAAIEETILVIQARKSRRRVVMSALRRLRSSRSSIVGVILTKFDHRS
                VIFDGPP                                                         
       730       740  
....:....|....:....|..
ADYAYTYAYSSYYYSYGDNRTA
ADYAYTYAYSSYYYSYGDNRTA
  YAYTYAYSSYYYSY      

© 1998-2019