BYKdb

Annotate results for A0A1B4NXZ0

A0A1B4NXZ0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B4NXZ0
DOMAINtad16/274SETDFVAVLDILLESRWLIAAITCALLAAGLAYAILGKPVFEANIMVQVEDSPDTSAAKS
LLGDVSSLFDVKSSAAAEQQILASRLVVERAVDKLNLFIDAQPKRFPLIGDWIARHSDGL
SDPGLAGFGGYVWARERIDVRRFDVPRKNEGDPFTLTSLGGKRYRLEGGDLDAPVEGTVG
ELERFRSPRGPITLQVASIAAKPGAAFVLVRNSRLKTIEDIRDRLNVQERVKQSDVVVAS
LQDTDPKWVSDTMNEIGRQ
DOMAINcd551/739AGPAPGVGKTFLSSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRGRGFTELIAGSAR
VEDVIHREVVDGLDFISTGTMPKNPAELLLNRNLATLVGDLSSRYDIVVIDSAPVLAVPD
TGILGAVAGTALLVTMAGKTKLGEIGESAKRFAQNGVRLNGVIFNGVNPRLGQYGYGSKY
GGYRYVAYE
SITE-688/-690GKT
SITEWalker A'578/585LLIDGDIR
SITEWalker B658/664VVIDSAP
SITEY Cluster724/740YGYGSKYGGYRYVAYEY
SITEWalker A558/560GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTQPSIPPQRPADDGSETDFVAVLDILLESRWLIAAITCALLAAGLAYAILGKPVFEANIMVQVEDSPDTSAAKSLLGDV
               SETDFVAVLDILLESRWLIAAITCALLAAGLAYAILGKPVFEANIMVQVEDSPDTSAAKSLLGDV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSLFDVKSSAAAEQQILASRLVVERAVDKLNLFIDAQPKRFPLIGDWIARHSDGLSDPGLAGFGGYVWARERIDVRRFDV
SSLFDVKSSAAAEQQILASRLVVERAVDKLNLFIDAQPKRFPLIGDWIARHSDGLSDPGLAGFGGYVWARERIDVRRFDV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRKNEGDPFTLTSLGGKRYRLEGGDLDAPVEGTVGELERFRSPRGPITLQVASIAAKPGAAFVLVRNSRLKTIEDIRDRL
PRKNEGDPFTLTSLGGKRYRLEGGDLDAPVEGTVGELERFRSPRGPITLQVASIAAKPGAAFVLVRNSRLKTIEDIRDRL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLTAQLPQLKQQLTDSEARLTKLRDERG
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQ                                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVDLTEEAKLALAQTADAKTRLLELQQKRQELLSRFTERHPSVAVIDEQIAALGGYRKAAEQQIRRLPDLQQEMVRLMLD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKVNTDLYTALLNNMQQLQLVQAGKTGNVRLVDTAAVPEVAVRPKKALVVLASVLLGLLAGCGTAILRSMLFHGVSDHNE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IERRLGLAVYATVPISDHQRDLAEEAARKSGHKSILAIDFPNEPAVECLRSLRTALQFAMLEAKNNIVLIAGPAPGVGKT
                                                                      AGPAPGVGKT
                                                                             GKT
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLSSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRGRGFTELIAGSARVEDVIHREVVDGLDFISTGTMPKNPAELLL
FLSSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRGRGFTELIAGSARVEDVIHREVVDGLDFISTGTMPKNPAELLL
                 LLIDGDIR                                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRNLATLVGDLSSRYDIVVIDSAPVLAVPDTGILGAVAGTALLVTMAGKTKLGEIGESAKRFAQNGVRLNGVIFNGVNPR
NRNLATLVGDLSSRYDIVVIDSAPVLAVPDTGILGAVAGTALLVTMAGKTKLGEIGESAKRFAQNGVRLNGVIFNGVNPR
                 VVIDSAP                                                        
       730       740     
....:....|....:....|....:
LGQYGYGSKYGGYRYVAYEYGVQDA
LGQYGYGSKYGGYRYVAYE      
   YGYGSKYGGYRYVAYEY     

© 1998-2019