BYKdb

Annotate results for A0A1B4NZS4

A0A1B4NZS4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B4NZS4
DOMAINtad20/277EDVVLGQLLQVLMDDIWLLLGIAVTVIALAGLYCYVAKPVYQADVHVRVEGNDNTTQALT
QTQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPLIGSLAARVAT
PGQPSRPWFGLRSYAWGGELAEVDTINVVPALEGKKLTLTAGPNGTYTLVDPDGRRLLSG
RVGESEQGGGVTLLVQKLVARPGTQFTVVRYNDLDAITGFQSGIQVSEQGKQTGVVQISL
EGKDPDQTAAIANALAQS
DOMAINcd555/741TGPTPGIGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSP
LEEAIRETPVQGLSFISAGTRPPNPSELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTD
ATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNGVPPKARGYGRGYAA
VHEYLSA
SITEWalker A562/564GKS
SITEWalker A'582/589LLIDADMR
SITEWalker B662/668VLIDSPP
SITEY Cluster728/738YGRGYAAVHEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVLMDDIWLLLGIAVTVIALAGLYCYVAKPVYQADVHVRVEGNDNTTQALTQ
                   EDVVLGQLLQVLMDDIWLLLGIAVTVIALAGLYCYVAKPVYQADVHVRVEGNDNTTQALTQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPLIGSLAARVATPGQPSRPWFGLRSYAWGGELA
TQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPLIGSLAARVATPGQPSRPWFGLRSYAWGGELA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVDTINVVPALEGKKLTLTAGPNGTYTLVDPDGRRLLSGRVGESEQGGGVTLLVQKLVARPGTQFTVVRYNDLDAITGFQ
EVDTINVVPALEGKKLTLTAGPNGTYTLVDPDGRRLLSGRVGESEQGGGVTLLVQKLVARPGTQFTVVRYNDLDAITGFQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVIAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
SGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQS                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSAMRPGDPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDRVERTFNLPLYGLVPQSAEQVKLDAMAEKGGSRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPG
                                                                          TGPTPG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEEAIRETPVQGLSFISAGTRPPNPS
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEEAIRETPVQGLSFISAGTRPPNPS
 GKS                 LLIDADMR                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
ELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
                     VLIDSPP                                                    
       730       740 
....:....|....:....|.
VPPKARGYGRGYAAVHEYLSA
VPPKARGYGRGYAAVHEYLSA
       YGRGYAAVHEY   

© 1998-2019