BYKdb

Annotate results for A0A1B4P3P3

A0A1B4P3P3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B4P3P3
DOMAINtad1/253MMIKNVRIIGIVACVFVLFGGLYALVAKPVYSVDIVVQVESNGADMMGGAAGSLVGGLSS
LFDVKSTDDGEMEILRSRLVTEPVVVDQRLAIEATPNHFPIIGAVIARFNKKLSTPGLFG
MGGFVWGGERISVSTFEVPRDFLEDRFFVTFLGDGRFRLSGSDLDAEATGRIGVPLHVGT
PAGDVTLTVAAIEARPGAQFVVKAFSKQKMLTKLQKALTITEKGKDQSGVIGVTYENDDP
VLGAGVLNEIADN
DOMAINcd531/718TGPAAGIGKSFISANVAALLGQSNKRVLLIDGDLRRGRLAKDFGTRSAPGLSSVLRGEAV
LDQAIVRGVSPHVDFLPTGPRVGQPVELFASNDLAVVVSEVSHRYDIVLLDAPPLLPVTD
ATVFARYAGTILLAARSGMTTQGEILESVKRIERVGATVTGVVFNGFRPGLRSAQYGNYG
AYAYEGAE
SITEWalker A538/540GKS
SITEWalker A'558/565LLIDGDLR
SITEWalker B638/644VLLDAPP
SITEY Cluster706/714YGNYGAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMIKNVRIIGIVACVFVLFGGLYALVAKPVYSVDIVVQVESNGADMMGGAAGSLVGGLSSLFDVKSTDDGEMEILRSRLV
MMIKNVRIIGIVACVFVLFGGLYALVAKPVYSVDIVVQVESNGADMMGGAAGSLVGGLSSLFDVKSTDDGEMEILRSRLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEPVVVDQRLAIEATPNHFPIIGAVIARFNKKLSTPGLFGMGGFVWGGERISVSTFEVPRDFLEDRFFVTFLGDGRFRLS
TEPVVVDQRLAIEATPNHFPIIGAVIARFNKKLSTPGLFGMGGFVWGGERISVSTFEVPRDFLEDRFFVTFLGDGRFRLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSDLDAEATGRIGVPLHVGTPAGDVTLTVAAIEARPGAQFVVKAFSKQKMLTKLQKALTITEKGKDQSGVIGVTYENDDP
GSDLDAEATGRIGVPLHVGTPAGDVTLTVAAIEARPGAQFVVKAFSKQKMLTKLQKALTITEKGKDQSGVIGVTYENDDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGAGVLNEIADNYVRQNADRKAATAEKSLRFLTEQVPDVEKQLRAVEDRLNAYQTKHEVIDLSEQAKAMLNQSVTAQTS
VLGAGVLNEIADN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFELEQKRKALASVYTPEHPQLASLDQQIAAAKANVGTFNDAIQRLPDAQQNIVRLRRDVTVQTEIYVGLLNSIQQLRLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASKIGNVRVIDHAIVPDQPVWPKPLLVVALAAVIGLVVGACVAIARAVLFGGVTDPSEIERDADLNVIATIPLSPVQRQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTRVGTGASQDAAILALARPHEPAVEALRSLCTALQFLLLDRPKNNVVLVTGPAAGIGKSFISANVAALLGQSNKRVLLI
                                                  TGPAAGIGKSFISANVAALLGQSNKRVLLI
                                                         GKS                 LLI
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDLRRGRLAKDFGTRSAPGLSSVLRGEAVLDQAIVRGVSPHVDFLPTGPRVGQPVELFASNDLAVVVSEVSHRYDIVLL
DGDLRRGRLAKDFGTRSAPGLSSVLRGEAVLDQAIVRGVSPHVDFLPTGPRVGQPVELFASNDLAVVVSEVSHRYDIVLL
DGDLR                                                                        VLL
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAPPLLPVTDATVFARYAGTILLAARSGMTTQGEILESVKRIERVGATVTGVVFNGFRPGLRSAQYGNYGAYAYEGAEAE
DAPPLLPVTDATVFARYAGTILLAARSGMTTQGEILESVKRIERVGATVTGVVFNGFRPGLRSAQYGNYGAYAYEGAE  
DAPP                                                             YGNYGAYAY      
      
....:.
TRVERM


© 1998-2019