BYKdb

Annotate results for A0A1B4SEY5

A0A1B4SEY5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B4SEY5
DOMAINtad20/277EDVVLGQMIQVILDDIWLLLGIAFVVIALAGLYCYVAKPVYSADAQVRVEVGDNTSQALT
QTQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPDTFPILGAIAARLAA
PDHPAKPWLGLSSYAWGGEDANVDSIDVSPALEGKKLTLTAGADGGYTLADPDGNLLVRG
KVGESEQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQSAIQVAEQGKQTGVIQISL
EGKDPEQTAQIANALAQS
DOMAINcd553/739TGPTPGIGKSFLAVNLAALVAHSGKRVLLIDADMRRGTLDRYFGMGEKNGLSELLSDQVA
LEESIRETSVPGLSFIPSGSRPPNPSELLMSPRLSQYLDGLAKRYDMVIVDSPPILAVTD
ATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVPARTRGYGRGYAA
VHEYLSA
SITEWalker A560/562GKS
SITEWalker A'580/587LLIDADMR
SITEWalker B660/666VIVDSPP
SITEY Cluster726/736YGRGYAAVHEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIAFVVIALAGLYCYVAKPVYSADAQVRVEVGDNTSQALTQ
                   EDVVLGQMIQVILDDIWLLLGIAFVVIALAGLYCYVAKPVYSADAQVRVEVGDNTSQALTQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPDTFPILGAIAARLAAPDHPAKPWLGLSSYAWGGEDA
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPDTFPILGAIAARLAAPDHPAKPWLGLSSYAWGGEDA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVDSIDVSPALEGKKLTLTAGADGGYTLADPDGNLLVRGKVGESEQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
NVDSIDVSPALEGKKLTLTAGADGGYTLADPDGNLLVRGKVGESEQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQS                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLAALAQRYTDEHPLVVAAKQQLAQLEGERAKYDGKFRGLPATEVKAVAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAAALLGLILGTSVVFLRRNLFHGIED


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDRVERAFNLPLYGLVPMSAEQARFDAADKGSRVRPILACARPKDMSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
                                                                        TGPTPGIG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSFLAVNLAALVAHSGKRVLLIDADMRRGTLDRYFGMGEKNGLSELLSDQVALEESIRETSVPGLSFIPSGSRPPNPSEL
KSFLAVNLAALVAHSGKRVLLIDADMRRGTLDRYFGMGEKNGLSELLSDQVALEESIRETSVPGLSFIPSGSRPPNPSEL
KS                 LLIDADMR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
                   VIVDSPP                                                      
       730         
....:....|....:....
ARTRGYGRGYAAVHEYLSA
ARTRGYGRGYAAVHEYLSA
     YGRGYAAVHEY   

© 1998-2019