BYKdb

Annotate results for A0A1B4YR70

A0A1B4YR70 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B4YR70
DOMAINtad11/206DFIDIERLLGMAARQAKVVAVCAAIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIVDDI
SAASTTMQTDSAILSQIEILTSTRLAAVVVDKLKLDQNEAFMNPPQSALARGVGLIRSLI
QYVHPSAPMPGMGDFSKLDPATRDALIAAAGRDYAILKLQNEIRADRVGRSYVIALGYQA
TDPGLAKAITKAYADA
DOMAINcd577/768ISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQT
WQSVGKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPV
VDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLARYGSF
GASEKFFDKYST
SITEWalker A584/586GKS
SITEWalker A'604/611LLIDGDLR
SITEWalker B686/692IVVDLPP
SITEY Cluster766/770YSTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPNSDAANGEDFIDIERLLGMAARQAKVVAVCAAIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIVDDISAASTTMQTD
          DFIDIERLLGMAARQAKVVAVCAAIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIVDDISAASTTMQTD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAILSQIEILTSTRLAAVVVDKLKLDQNEAFMNPPQSALARGVGLIRSLIQYVHPSAPMPGMGDFSKLDPATRDALIAAA
SAILSQIEILTSTRLAAVVVDKLKLDQNEAFMNPPQSALARGVGLIRSLIQYVHPSAPMPGMGDFSKLDPATRDALIAAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRDYAILKLQNEIRADRVGRSYVIALGYQATDPGLAKAITKAYADAYLADQLDASFDATERAAVWLQGRLTELRESSQQA
GRDYAILKLQNEIRADRVGRSYVIALGYQATDPGLAKAITKAYADA                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLAVEKFRAEHGLSANSDGQLMSDKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSDNAFKDAAISADQPSSSVISA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKTRYLTVAKRQQDVEANFGPDHPQAVALAKEKADISKQIFGELKQLTESYRNEYEVAQARETALRANVAAAQGKSSIDN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSQVQLRDLDQKATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASTPLSASSPRTVIVLGLSLVLGVLMGAGFGGLN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFNERFFRTGEEVRDRVGLKFLGYLPTVGSRPAKEDKQAEAQPDAKTVRSPAANERRARMRVSIDAPSSMFAETLRSAKI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFDVVMEGQGSRVVGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQTWQSV
                ISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQTWQSV
                       GKS                 LLIDGDLR                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPR
GKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPR
                                             IVVDLPP                            
       730       740       750       760       770       780  
....:....|....:....|....:....|....:....|....:....|....:....|..
AMVRSMLESEPYVANKIVGAVLNKVDLKKLARYGSFGASEKFFDKYSTYYLDKSEVRTKAAV
AMVRSMLESEPYVANKIVGAVLNKVDLKKLARYGSFGASEKFFDKYST              
                                             YSTYY            

© 1998-2019