BYKdb

Annotate results for A0A1B7UIH4

A0A1B7UIH4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B7UIH4
DOMAINtad16/195EVIDLRKYFSVINRAKWRILLLAMLVSALTVFIVLNLKPVFSSRATLLIEAQQAKAVKIE
EVYGMNSAQQEYYLTQFEILKSRSIAETVIERLQLGKHSDFIAETSLMTELKKQLPFLPD
DAADLLSEEDKAARIKEKLVEKFVAKLSIDPVRKTQLVNITFESHDAKLAAAVANAVGDA
DOMAINcd540/730TSSIPEEGKSTVSSNIAFAFGQLEKILLIDADMRKPTIAKRFALPAFQPGLANYLSETES
LDECIVHDEATGIDILTAGTIPLNPLELLSHPRFEALLVELKSRYQKIVIDTPPVHAVSD
ALVISRFADAVLMVVKADQTRSGLIQHSLSKLVHAHAKVFGVVLNDLDLKKAEKYYGSYG
YYQYYAEKSES
SITEWalker A547/549GKS
SITEWalker A'566/573LLIDADMR
SITEWalker B647/653IVIDTPP
SITEY Cluster714/724YYGSYGYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLAVEPQGVGQVNEEVIDLRKYFSVINRAKWRILLLAMLVSALTVFIVLNLKPVFSSRATLLIEAQQAKAVKIEEVYGM
               EVIDLRKYFSVINRAKWRILLLAMLVSALTVFIVLNLKPVFSSRATLLIEAQQAKAVKIEEVYGM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSAQQEYYLTQFEILKSRSIAETVIERLQLGKHSDFIAETSLMTELKKQLPFLPDDAADLLSEEDKAARIKEKLVEKFVA
NSAQQEYYLTQFEILKSRSIAETVIERLQLGKHSDFIAETSLMTELKKQLPFLPDDAADLLSEEDKAARIKEKLVEKFVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLSIDPVRKTQLVNITFESHDAKLAAAVANAVGDAYIESQLEAKMGITQKANAWLGGRLGELRLRLDESELALQQFRVRE
KLSIDPVRKTQLVNITFESHDAKLAAAVANAVGDA                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLIDVAGVRSLGSQELERLGVEITQSRAKKAQVDGFIRVISQYGTDKIDRLESLPEITAHPGVQNVKKEVISAERKVSEL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKIYGPKHPKLLAAKSELTTVQDNLRDQIRKLISGIENEAQTASENLQSLETEMARAKVQYQDLSGKETEYQRLQREVET


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRQLFDTFMARQKETEVAGDFNSAIARFTDRAMPATEPMKPKRKLIVILAFIAALGFGVIVAFVMESLNDTIKTTNDVEQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLQQRALGVVPKVPGKMALKDINTMFFNAEQRQFSESIRSIRTSISLLALDKPLQIIEVTSSIPEEGKSTVSSNIAFAFG
                                                           TSSIPEEGKSTVSSNIAFAFG
                                                                  GKS           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLEKILLIDADMRKPTIAKRFALPAFQPGLANYLSETESLDECIVHDEATGIDILTAGTIPLNPLELLSHPRFEALLVEL
QLEKILLIDADMRKPTIAKRFALPAFQPGLANYLSETESLDECIVHDEATGIDILTAGTIPLNPLELLSHPRFEALLVEL
     LLIDADMR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSRYQKIVIDTPPVHAVSDALVISRFADAVLMVVKADQTRSGLIQHSLSKLVHAHAKVFGVVLNDLDLKKAEKYYGSYGY
KSRYQKIVIDTPPVHAVSDALVISRFADAVLMVVKADQTRSGLIQHSLSKLVHAHAKVFGVVLNDLDLKKAEKYYGSYGY
      IVIDTPP                                                            YYGSYGY
       730 
....:....|.
YQYYAEKSESS
YQYYAEKSES 
YQYY       

© 1998-2019