BYKdb

Annotate results for A0A1B7WWU1

A0A1B7WWU1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B7WWU1
DOMAINcd181/368TSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQ
LKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVIIDTPPLTAVTDP
LIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSG
YYGGKGER
SITEWalker A188/190GKS
SITEWalker A'208/215LLVDADMR
SITEWalker B287/293VIIDTPP
SITEY Cluster352/362YGGYYYSSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPELPVSPKI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQHGEKNPKNPQEGRQELPLLDDPYSPVSTSFE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQTNLGFTVSDKELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQ
                    TSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQ
                           GKS                 LLVDADMR                         
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVIIDTPPLTAVTDPLIVGKYVDGLLLVVRPGKVE
LKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVIIDTPPLTAVTDPLIVGKYVDGLLLVVRPGKVE
                                              VIIDTPP                           
       330       340       350       360       370        
....:....|....:....|....:....|....:....|....:....|....:...
YSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGGKGERNKQNAEASVR
YSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGGKGER          
                               YGGYYYSSGYY                
© 1998-2019