BYKdb

Annotate results for A0A1B8RQ73

A0A1B8RQ73 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B8RQ73
DOMAINcd35/211TSSEKGEGKSTTATNLAISLSFDKKKVLLVDCDLRRPSLHKYLRISGECGLTEVIIGETN
VEKAIVNIKDNLFFLPSGNRPPNPAELLGSENFELMLKELKDIFDYIIIDSPPLRVVADA
QILSSKVDGVILVVKYGFTKKDELLVCRETLELVGGKLIGTVINGDKKENDYKYYYY
SITEWalker A42/44GKS
SITEWalker A'62/69LLVDCDLR
SITEWalker B141/147IIIDSPP
SITEY Cluster206/211YKYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLENPTTIYAEAYSKLKTSIKYSSADKNNKVFLITSSEKGEGKSTTATNLAISLSFDKKKVLLVDCDLRRPSLHKYLRIS
                                  TSSEKGEGKSTTATNLAISLSFDKKKVLLVDCDLRRPSLHKYLRIS
                                         GKS                 LLVDCDLR           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GECGLTEVIIGETNVEKAIVNIKDNLFFLPSGNRPPNPAELLGSENFELMLKELKDIFDYIIIDSPPLRVVADAQILSSK
GECGLTEVIIGETNVEKAIVNIKDNLFFLPSGNRPPNPAELLGSENFELMLKELKDIFDYIIIDSPPLRVVADAQILSSK
                                                            IIIDSPP             
       170       180       190       200       210 
....:....|....:....|....:....|....:....|....:....|.
VDGVILVVKYGFTKKDELLVCRETLELVGGKLIGTVINGDKKENDYKYYYY
VDGVILVVKYGFTKKDELLVCRETLELVGGKLIGTVINGDKKENDYKYYYY
                                             YKYYYY
© 1998-2019