BYKdb

Annotate results for A0A1B8RSH5

A0A1B8RSH5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B8RSH5
DOMAINcd38/219TSSEPGEGKSTTAGNMALSFAQSEKSVILIDCDLRKPSLHRKFKISNLVGLSDVLIGKEK
MNDAVNEYSENLHILTSGKLPPNPSEMLGSKAMGRLLEELKSKYDIIILDSAPLQAVTDA
QILSTKVDGTILVVRAEKTKRDSVQQAKALLDKVGANVLGTVLNGVENTRKKYYYYYGNE
GK
SITEWalker A45/47GKS
SITEWalker A'65/72ILIDCDLR
SITEWalker B144/150IILDSAP
SITEY Cluster210/214YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFIVEKKPNSIAAEAYRTLRTNIQYSSFDKEIKTMVVTSSEPGEGKSTTAGNMALSFAQSEKSVILIDCDLRKPSLHRKF
                                     TSSEPGEGKSTTAGNMALSFAQSEKSVILIDCDLRKPSLHRKF
                                            GKS                 ILIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KISNLVGLSDVLIGKEKMNDAVNEYSENLHILTSGKLPPNPSEMLGSKAMGRLLEELKSKYDIIILDSAPLQAVTDAQIL
KISNLVGLSDVLIGKEKMNDAVNEYSENLHILTSGKLPPNPSEMLGSKAMGRLLEELKSKYDIIILDSAPLQAVTDAQIL
                                                               IILDSAP          
       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
STKVDGTILVVRAEKTKRDSVQQAKALLDKVGANVLGTVLNGVENTRKKYYYYYGNEGK
STKVDGTILVVRAEKTKRDSVQQAKALLDKVGANVLGTVLNGVENTRKKYYYYYGNEGK
                                                 YYYYY     
© 1998-2019