BYKdb

Annotate results for A0A1B8SWB6

A0A1B8SWB6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B8SWB6
DOMAINtad13/243DEIDLLALFKVLKSNIIKIGFFTVIFAAIAIAYSLLATPIYQANATLQYDKLGQVSLLDQ
MSDVMPFGNSNNQVDSEIEVIKSRMVLGKTVADLNLDTQAAPEGFVSKLLGEVAPVHIAL
FQLPENLIGQPLTLTYLGDNNYSLNVDGQVLQGKVGEVLKQGEINLLISSFAAETGEEFS
LIKNARYSTIEDLRNTLTIAEVGKGTGIISLAIKGADKVENVNILNSVIQN
DOMAINcd514/693TSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRLHKAFGLNNKAGLSEYLSQQNI
ESPTIHANVIENLDVICRGKNVTHSSELLMGERFKQLLDKVKNQYDIVVIDTAPILAITD
SAIIGKYVGTSLLIAFYGVNTVKDVDLSLKRFKQNDIEITGVILNGIDARSDDYNYHYEY
SITEWalker A521/523GKS
SITEWalker A'541/548LLIDTDLR
SITEWalker B621/627VVIDTAP
SITEY Cluster687/693YNYHYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMNTTKNSSPASDEIDLLALFKVLKSNIIKIGFFTVIFAAIAIAYSLLATPIYQANATLQYDKLGQVSLLDQMSDVMPFG
            DEIDLLALFKVLKSNIIKIGFFTVIFAAIAIAYSLLATPIYQANATLQYDKLGQVSLLDQMSDVMPFG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSNNQVDSEIEVIKSRMVLGKTVADLNLDTQAAPEGFVSKLLGEVAPVHIALFQLPENLIGQPLTLTYLGDNNYSLNVDG
NSNNQVDSEIEVIKSRMVLGKTVADLNLDTQAAPEGFVSKLLGEVAPVHIALFQLPENLIGQPLTLTYLGDNNYSLNVDG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVLQGKVGEVLKQGEINLLISSFAAETGEEFSLIKNARYSTIEDLRNTLTIAEVGKGTGIISLAIKGADKVENVNILNSV
QVLQGKVGEVLKQGEINLLISSFAAETGEEFSLIKNARYSTIEDLRNTLTIAEVGKGTGIISLAIKGADKVENVNILNSV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQNYVDQNTERKKEVTNNTLVFLDGYLPTIKKKLDNYENQLNAFRKKNESIDLSLEAKAALDTALQVEEKLNELTFKEVE
IQN                                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQQLYTRNHPAYQSLLDKRQQLLREKEKISKNIQKLPNTQQEIVRLTRDVEAEQAIYAQLVAKQQELSVLNSGITADVRI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDSAESQPKPVAPKKSLIIALATILGFIVGCAYVIAREFFNNKIKSTEDIDALGVNVYATIPFSAHEKKLIEAGNKSPLA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IENPADTAVEAIRSLRTSVYFSVMNQGNNLVMVTSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRLHKAFGLNN
                                 TSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRLHKAFGLNN
                                        GKS                 LLIDTDLR            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAGLSEYLSQQNIESPTIHANVIENLDVICRGKNVTHSSELLMGERFKQLLDKVKNQYDIVVIDTAPILAITDSAIIGKY
KAGLSEYLSQQNIESPTIHANVIENLDVICRGKNVTHSSELLMGERFKQLLDKVKNQYDIVVIDTAPILAITDSAIIGKY
                                                            VVIDTAP             
       650       660       670       680       690   
....:....|....:....|....:....|....:....|....:....|...
VGTSLLIAFYGVNTVKDVDLSLKRFKQNDIEITGVILNGIDARSDDYNYHYEY
VGTSLLIAFYGVNTVKDVDLSLKRFKQNDIEITGVILNGIDARSDDYNYHYEY
                                              YNYHYEY
© 1998-2019