BYKdb

Annotate results for A0A1B8VZJ1

A0A1B8VZJ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B8VZJ1
DOMAINcd48/229TSSGPEEGKSTVSANLAAAYAQSDKKVLLIDGDLRKPTAHKTFKLSNRYGLSSLLSKQAD
LEDVVQESGVPNLSLITSGPLPPNPAEMMASNRMTTVLQEMREVFDIVIIDTPPLLAVTD
AQIVASKSDGVIMVVSYGKVKRDIAMKAKSGLDRVGAKMLGVVLNNVKRKASEGYYYYYY
GN
SITEWalker A55/57GKS
SITEWalker A'75/82LLIDGDLR
SITEWalker B155/161VIIDTPP
SITEY Cluster222/227YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQSPNNQQRHLITVTNPRSPISEAFRALRTNIDFSSVDEKIQIIMITSSGPEEGKSTVSANLAAAYAQSDKKVLLIDGD
                                               TSSGPEEGKSTVSANLAAAYAQSDKKVLLIDGD
                                                      GKS                 LLIDGD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKPTAHKTFKLSNRYGLSSLLSKQADLEDVVQESGVPNLSLITSGPLPPNPAEMMASNRMTTVLQEMREVFDIVIIDTP
LRKPTAHKTFKLSNRYGLSSLLSKQADLEDVVQESGVPNLSLITSGPLPPNPAEMMASNRMTTVLQEMREVFDIVIIDTP
LR                                                                        VIIDTP
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
PLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAMKAKSGLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
PLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAMKAKSGLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
P                                                            YYYYYY  
© 1998-2019