BYKdb

Annotate results for A0A1B8W3L6

A0A1B8W3L6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B8W3L6
DOMAINcd46/230SSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLRKPTAHHTFSISNRWGLSSVISQQCS
LEEVLQVTDIPNLDVITSGAIPPNPAEMMNSKRMTAIIAQLRGMYDIILIDTPPLLAVTD
AQIVATKSDGVILVVDQGKVKREIAGKAVKNLESVNARILGVVLNNVKRRANEESYYYYY
GVQDK
SITEWalker A53/55GKS
SITEWalker A'73/80VLIDADLR
SITEWalker B153/159ILIDTPP
SITEY Cluster221/225YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRSKNKRQIITLTNPRSPISESYRALRTNIEFSSIDEKLQVLMVSSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
                                             SSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
                                                    GKS                 VLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTAHHTFSISNRWGLSSVISQQCSLEEVLQVTDIPNLDVITSGAIPPNPAEMMNSKRMTAIIAQLRGMYDIILIDTPPL
KPTAHHTFSISNRWGLSSVISQQCSLEEVLQVTDIPNLDVITSGAIPPNPAEMMNSKRMTAIIAQLRGMYDIILIDTPPL
                                                                        ILIDTPP 
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVTDAQIVATKSDGVILVVDQGKVKREIAGKAVKNLESVNARILGVVLNNVKRRANEESYYYYYGVQDK
LAVTDAQIVATKSDGVILVVDQGKVKREIAGKAVKNLESVNARILGVVLNNVKRRANEESYYYYYGVQDK
                                                            YYYYY     
© 1998-2019