BYKdb

Annotate results for A0A1B8WAI5

A0A1B8WAI5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B8WAI5
DOMAINcd46/230TSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLRKPSQHHIFGKSNRSGLTTALFNQLK
LEDIIQFTGTENLSIIQAGPTPPNPSELLSSDQMADLLKKARERYDVIIIDTPPIMSVTD
AQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVKARLIGVVLNKINRNHSDIYSYYYG
EKTDA
SITE-89/-91GKS
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159IIIDTPP
SITEY Cluster220/224YSYYY
SITEWalker A53/55GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRLIPKWNLITELNPKSPISEGYRMLRTNIEFSTINQKLQIIMVTSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
                                             TSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
                                                    GKS                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSQHHIFGKSNRSGLTTALFNQLKLEDIIQFTGTENLSIIQAGPTPPNPSELLSSDQMADLLKKARERYDVIIIDTPPI
KPSQHHIFGKSNRSGLTTALFNQLKLEDIIQFTGTENLSIIQAGPTPPNPSELLSSDQMADLLKKARERYDVIIIDTPPI
                                                                        IIIDTPP 
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVKARLIGVVLNKINRNHSDIYSYYYGEKTDA
MSVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVKARLIGVVLNKINRNHSDIYSYYYGEKTDA
                                                           YSYYY      
© 1998-2019