BYKdb

Annotate results for A0A1B9AL51

A0A1B9AL51 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B9AL51
DOMAINcd53/232TSSGPTEGKSTTAANIAVVFAQQGKRTLFIDADLRKPSSHYTFSFTNNVGLTSVLTRQIE
LGKAIQIVEPLGLHVLTSGPLPPNPAELLSSKSMNELINQTKEDFDIIIVDTPPITAVTD
AQIIANICQGVVLVVSSGRTQVEDAVKTKELLLNTGTKILGAVLNNRKMKDNTYYYYGKK
SITEWalker A60/62GKS
SITEWalker A'80/87LFIDADLR
SITEWalker B160/166IIVDTPP
SITEY Cluster226/229YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKKSRQFGNSNQRKLVTYLEPKSPISEQFRTLRTNIQYSFIDEEMQTIMITSSGPTEGKSTTAANIAVVFAQQGKRTL
                                                    TSSGPTEGKSTTAANIAVVFAQQGKRTL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIDADLRKPSSHYTFSFTNNVGLTSVLTRQIELGKAIQIVEPLGLHVLTSGPLPPNPAELLSSKSMNELINQTKEDFDII
FIDADLRKPSSHYTFSFTNNVGLTSVLTRQIELGKAIQIVEPLGLHVLTSGPLPPNPAELLSSKSMNELINQTKEDFDII
FIDADLR                                                                        I
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
IVDTPPITAVTDAQIIANICQGVVLVVSSGRTQVEDAVKTKELLLNTGTKILGAVLNNRKMKDNTYYYYGKK
IVDTPPITAVTDAQIIANICQGVVLVVSSGRTQVEDAVKTKELLLNTGTKILGAVLNNRKMKDNTYYYYGKK
IVDTPP                                                           YYYY   
© 1998-2019