BYKdb

Annotate results for A0A1B9AQ17

A0A1B9AQ17 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B9AQ17
DOMAINcd51/226TSASPGEGKSTTTANLAVVFAKHGKSVLLIDADLRKPTVHYTFSVKNYRGLSNILVGEAT
LIEAVVASEVENLDILTSGPIPPNPSELLDSKRMETLLQEAKSHYDIVLIDTPPVLVLTD
TQILANLCDGSILVVRNKVTQLEDAQKAIEVLKASEGKVLGTVLNGTSSKETNYYY
SITE-74/-76GKS
SITEWalker A'78/85LLIDADLR
SITEWalker B158/164VLIDTPP
SITEY Cluster224/226YYY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSREKAQSKTSPRFLITKLHPRSYISEQYRTVRTNIQFASADADVRTLLVTSASPGEGKSTTTANLAVVFAKHGKSVLLI
                                                  TSASPGEGKSTTTANLAVVFAKHGKSVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPTVHYTFSVKNYRGLSNILVGEATLIEAVVASEVENLDILTSGPIPPNPSELLDSKRMETLLQEAKSHYDIVLI
DADLRKPTVHYTFSVKNYRGLSNILVGEATLIEAVVASEVENLDILTSGPIPPNPSELLDSKRMETLLQEAKSHYDIVLI
DADLR                                                                        VLI
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
DTPPVLVLTDTQILANLCDGSILVVRNKVTQLEDAQKAIEVLKASEGKVLGTVLNGTSSKETNYYY
DTPPVLVLTDTQILANLCDGSILVVRNKVTQLEDAQKAIEVLKASEGKVLGTVLNGTSSKETNYYY
DTPP                                                           YYY
© 1998-2019