BYKdb

Annotate results for A0A1B9AVC6

A0A1B9AVC6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B9AVC6
DOMAINcd54/236TSSGPAEGKSTTAANMAVVFAQTGKKVLLIDSDLRRPTVHYTFSLPNTYGLTNVLTKQIQ
FEEAIRETEVENLFIMTSGPIPPNPAELLGAATMNQLFETAYSHFDIVLFDTPPVLAVTD
AQILANKCDGTLLVIYSGKTIIEQVTKAKELLEAAQGKLLGTVLNHKEIKGNDYYYYQYY
GGK
SITE-191/-193GKT
SITEWalker A'81/88LLIDSDLR
SITEWalker B161/167VLFDTPP
SITEY Cluster227/233YYYYQYY
SITEWalker A61/63GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALNRRKKPQTGDKRVKLVTLFDPKSTISEQYRTIRTNIQFSSVDREIRSLMITSSGPAEGKSTTAANMAVVFAQTGKKV
                                                     TSSGPAEGKSTTAANMAVVFAQTGKKV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDSDLRRPTVHYTFSLPNTYGLTNVLTKQIQFEEAIRETEVENLFIMTSGPIPPNPAELLGAATMNQLFETAYSHFDI
LLIDSDLRRPTVHYTFSLPNTYGLTNVLTKQIQFEEAIRETEVENLFIMTSGPIPPNPAELLGAATMNQLFETAYSHFDI
LLIDSDLR                                                                        
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
VLFDTPPVLAVTDAQILANKCDGTLLVIYSGKTIIEQVTKAKELLEAAQGKLLGTVLNHKEIKGNDYYYYQYYGGK
VLFDTPPVLAVTDAQILANKCDGTLLVIYSGKTIIEQVTKAKELLEAAQGKLLGTVLNHKEIKGNDYYYYQYYGGK
VLFDTPP                                                           YYYYQYY   
© 1998-2019