BYKdb

Annotate results for A0A1B9AYT6

A0A1B9AYT6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B9AYT6
DOMAINcd55/235TSAGPGEGKSTTTANLAIVFAQQGKKVLLVDADMRKPTMQYTFNTSNTIGLTNVLAKQKV
LEAAVFETDVDGLDLLSSGPIPPNPAELLGSKAMAELVQEAYDQYDVVIFDTPPVLAVTD
AQVLANQCDGTVLVINSGKTEIDGASKAKELLESAKAKLLGVVLNNRKLKESSYYYYYGT
K
SITE-192/-194GKT
SITEWalker A'82/89LLVDADMR
SITEWalker B162/168VIFDTPP
SITE-156/-159YDQY
SITEY Cluster228/232YYYYY
SITEWalker A62/64GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALKKNKKKEAPGQAQRKLIAKTDPKSPISEQYRTIRTNILFSSVDQEIRSLMVTSAGPGEGKSTTTANLAIVFAQQGKK
                                                      TSAGPGEGKSTTTANLAIVFAQQGKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLVDADMRKPTMQYTFNTSNTIGLTNVLAKQKVLEAAVFETDVDGLDLLSSGPIPPNPAELLGSKAMAELVQEAYDQYD
VLLVDADMRKPTMQYTFNTSNTIGLTNVLAKQKVLEAAVFETDVDGLDLLSSGPIPPNPAELLGSKAMAELVQEAYDQYD
 LLVDADMR                                                                       
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
VVIFDTPPVLAVTDAQVLANQCDGTVLVINSGKTEIDGASKAKELLESAKAKLLGVVLNNRKLKESSYYYYYGTK
VVIFDTPPVLAVTDAQVLANQCDGTVLVINSGKTEIDGASKAKELLESAKAKLLGVVLNNRKLKESSYYYYYGTK
 VIFDTPP                                                           YYYYY   
© 1998-2019