BYKdb

Annotate results for A0A1B9B2F8

A0A1B9B2F8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1B9B2F8
DOMAINcd43/219TSPNHGDGKTTTAANLGIVLAQHDKKVIVIDADLRRPKIHKLFDLKQSDGLTAILAGKAT
VDEAICISDIPNLHIIQSGPVTKTSYELLTANRIEDIISILSQQYDTIIFDTSPILYTAE
TQILANLCEASMLVVKSGQTLKEDARKAVNVLQDSKAELLGASLNGNPIKPKAYQYN
SITEWalker A50/52GKT
SITEWalker A'70/77IVIDADLR
SITEWalker B150/156IIFDTSP
SITEY Cluster216/218YQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKERAKYAQIYKQSIVSEQYRLLRSSITFSRIGKDIQTLLVTSPNHGDGKTTTAANLGIVLAQHDKKVIVIDADLRRPK
                                          TSPNHGDGKTTTAANLGIVLAQHDKKVIVIDADLRRPK
                                                 GKT                 IVIDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IHKLFDLKQSDGLTAILAGKATVDEAICISDIPNLHIIQSGPVTKTSYELLTANRIEDIISILSQQYDTIIFDTSPILYT
IHKLFDLKQSDGLTAILAGKATVDEAICISDIPNLHIIQSGPVTKTSYELLTANRIEDIISILSQQYDTIIFDTSPILYT
                                                                     IIFDTSP    
       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
AETQILANLCEASMLVVKSGQTLKEDARKAVNVLQDSKAELLGASLNGNPIKPKAYQYN
AETQILANLCEASMLVVKSGQTLKEDARKAVNVLQDSKAELLGASLNGNPIKPKAYQYN
                                                       YQY 
© 1998-2019