BYKdb

Annotate results for A0A1B9BXI4

A0A1B9BXI4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B9BXI4
DOMAINtad32/185DEINLGPVLQAIKTGWKWPVIVGGAFAFLAVILVLISPPVFNAKGTLYLGQAEKDHSGSS
SGVEGLSQLTGIAQGSSMVTQIEILQSRDIVRRAILASGINAQAWKTAHPPSGLTDAGWR
LGGEKLSLYAPAADALRALYAHVTDPSLKDQTLT
DOMAINcd630/817TSATPGDGKSSLTFQIAAALAQDGKKVLLIDADLRNPHAHSAFGITQEPGLAGILAGRST
GQEAVHHNEKMGIDVITAGNIPPNPSEHLGSGKMAQLLTDLRPHYDYILMDTPPFPMVGD
VLIVGPFVDRLLTIAKIDHTPRRAYQEHLQGILSLGRPLGLIINGIRVHGSYGYGYGYGV
DTDGQSLQ
SITEWalker A637/639GKS
SITEWalker A'657/664LLIDADLR
SITEWalker B737/743ILMDTPP
SITE-734/-736YDY
SITEY Cluster801/807YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIDNGTAQNTSNSGSATSHAGMLGGHDAGASDEINLGPVLQAIKTGWKWPVIVGGAFAFLAVILVLISPPVFNAKGTLYL
                               DEINLGPVLQAIKTGWKWPVIVGGAFAFLAVILVLISPPVFNAKGTLYL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQAEKDHSGSSSGVEGLSQLTGIAQGSSMVTQIEILQSRDIVRRAILASGINAQAWKTAHPPSGLTDAGWRLGGEKLSLY
GQAEKDHSGSSSGVEGLSQLTGIAQGSSMVTQIEILQSRDIVRRAILASGINAQAWKTAHPPSGLTDAGWRLGGEKLSLY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APAADALRALYAHVTDPSLKDQTLTVDFDSGGRYRILHGQQVLLSGQLNQPAVGSGLRLELRAASVPRVHTLYHLRIENA
APAADALRALYAHVTDPSLKDQTLT                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVYHAMAQSGAISVLRGSGVGILDAKRSYLVSVSVQNANPFIAEDFANALMQTYLNETRSWSTDQAGATYDYLGEQLKK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRSALTTADAHLAHYQSKSGVIAVSSGAKAMIGQLANYETQRSQIKITLYGLTQIRQALAQPGSALNPYLFSSIQDPVLN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLSSQLATAQSALTVLLKQYTHAAPQVVQAQAEIASIRSAISTLVQNQEKIATQQLQSINTIISEQQASMSEYPRSELEV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISLTRSSEVLGKLYMFLLQKQEEAAINKASTLTKNRILDTALVGNLPVAPNAKREVLLYGLLGVLLGLSVVIVRYLLHPG


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRSDEELRQRYPFLPVYGLLPLAPTTSRNKETLFRIPDPRSGYGEALRLLRSNFYLAAGKDGGGQVVALTSATPGDGKSS
                                                                     TSATPGDGKSS
                                                                            GKS 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTFQIAAALAQDGKKVLLIDADLRNPHAHSAFGITQEPGLAGILAGRSTGQEAVHHNEKMGIDVITAGNIPPNPSEHLGS
LTFQIAAALAQDGKKVLLIDADLRNPHAHSAFGITQEPGLAGILAGRSTGQEAVHHNEKMGIDVITAGNIPPNPSEHLGS
                LLIDADLR                                                        
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKMAQLLTDLRPHYDYILMDTPPFPMVGDVLIVGPFVDRLLTIAKIDHTPRRAYQEHLQGILSLGRPLGLIINGIRVHGS
GKMAQLLTDLRPHYDYILMDTPPFPMVGDVLIVGPFVDRLLTIAKIDHTPRRAYQEHLQGILSLGRPLGLIINGIRVHGS
                ILMDTPP                                                         
       810       820       830    
....:....|....:....|....:....|....
YGYGYGYGVDTDGQSLQPAAKGWRRLLKRLGKKR
YGYGYGYGVDTDGQSLQ                 
YGYGYGY                           

© 1998-2019