BYKdb

Annotate results for A0A1B9PQN2

A0A1B9PQN2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B9PQN2
DOMAINtad16/256DEIDLAKLFGQLIDGRWLIISITTVFAIAGIAFALLSTPIYKADALVQVEQKTGGGMSAL
VGDMGDMFASESSSTTEIEIIKSRMILGDTVDKLNLTTITAPQYMPIIGKGLSRLMGEGK
AINVSRFDIPKYIDEPNFTLVLDDAEKGTYTLFDAEERKVLTGKVGELADNNDYHLFVMQ
LTGETGDLFSVSKVSRFDAILTLQQTLSISEKGKQSGVLQFSLEGENKAKIEAIINDVSQ
N
DOMAINcd534/721TGPAPNIGKSFVAVNFAAVIAKTGQKVLVVDADMRKGYMQRYFGMKWDNGLSDYLSGKLP
LEQSIQKSEVPNLDVMTRGQIPPNPSELLMTKRFSDFIDWASNNYDLVLIDTPPVLAVTD
PSIVGALTGTTLMVGRFDQTSIKEIDVARHRFEQAGIEVKGFILNAVEKKASNTYGYGYY
NYSYESDK
SITEWalker A541/543GKS
SITEWalker A'561/568LVVDADMR
SITEWalker B641/647VLIDTPP
SITE-571/-575YMQRY
SITEY Cluster708/717YGYGYYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQATNANRESSSSSDEIDLAKLFGQLIDGRWLIISITTVFAIAGIAFALLSTPIYKADALVQVEQKTGGGMSALVGDMG
               DEIDLAKLFGQLIDGRWLIISITTVFAIAGIAFALLSTPIYKADALVQVEQKTGGGMSALVGDMG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DMFASESSSTTEIEIIKSRMILGDTVDKLNLTTITAPQYMPIIGKGLSRLMGEGKAINVSRFDIPKYIDEPNFTLVLDDA
DMFASESSSTTEIEIIKSRMILGDTVDKLNLTTITAPQYMPIIGKGLSRLMGEGKAINVSRFDIPKYIDEPNFTLVLDDA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKGTYTLFDAEERKVLTGKVGELADNNDYHLFVMQLTGETGDLFSVSKVSRFDAILTLQQTLSISEKGKQSGVLQFSLEG
EKGTYTLFDAEERKVLTGKVGELADNNDYHLFVMQLTGETGDLFSVSKVSRFDAILTLQQTLSISEKGKQSGVLQFSLEG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENKAKIEAIINDVSQNYFLQNIARDSAEAENSLAFLNTQIPAIKDKLTLSENVLNDFRLERKSVDLSLEARSALDVLVKL
ENKAKIEAIINDVSQN                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETQLNELTFKESEISQRFTKDHPAYKSLLDKRQVLLGEKDRLNLQVQKLPKTQREVLRMQRDVELNQQIYIQLLNKSQEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIIKAGTVGNVRILDTAQAYSRAVKPKKPLIVVLATLLGGMLSVAIVLLKAAFHRGVENPDEIEALGIPVYASIPKSKWQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKLDIRYSKKKVRHLETLLAESNPADLSIEALRGLRTSMHFAMMEAKNNVVMITGPAPNIGKSFVAVNFAAVIAKTGQKV
                                                     TGPAPNIGKSFVAVNFAAVIAKTGQKV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVVDADMRKGYMQRYFGMKWDNGLSDYLSGKLPLEQSIQKSEVPNLDVMTRGQIPPNPSELLMTKRFSDFIDWASNNYDL
LVVDADMRKGYMQRYFGMKWDNGLSDYLSGKLPLEQSIQKSEVPNLDVMTRGQIPPNPSELLMTKRFSDFIDWASNNYDL
LVVDADMR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIDTPPVLAVTDPSIVGALTGTTLMVGRFDQTSIKEIDVARHRFEQAGIEVKGFILNAVEKKASNTYGYGYYNYSYESD
VLIDTPPVLAVTDPSIVGALTGTTLMVGRFDQTSIKEIDVARHRFEQAGIEVKGFILNAVEKKASNTYGYGYYNYSYESD
VLIDTPP                                                            YGYGYYNYSY   
  
..
KK
K 

© 1998-2019