BYKdb

Annotate results for A0A1B9SJP6

A0A1B9SJP6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B9SJP6
DOMAINtad21/204SFIDIDRLIAIVIRRAGSIALCVGAMVAVAVVYLLFSTSQYTSMTQILLDDSMTKYAQDQ
PPIANSQQVDMQIASAVEILKSNQLALRVVDAEKLQDNDTLLDPPQSPVALVKSGVKLIM
SALLPGKPPANEDDERNGRRQKAASLLQDAVTVSRVNRSAVLAVSFRSTDRLLAARITKA
YATA
DOMAINcd578/769VSAMPGEGKSTTSANFAALLASSGKRTLLIDADLRNPGLTRMLKKPPQHGLVEAVLGEVP
WASAVKVDPVTKLAILPVLPNDHLMHTSELLASQGMFNLMENARKMFDYIVVDLAPLGPV
IDAKAFAPQVDGFLFVTEWGATPTNVVRDLLNAEPQIKSKILGVILNKTDMTELGKFTNF
GGAERYRQKYVS
SITEWalker A585/587GKS
SITEWalker A'605/612LLIDADLR
SITEWalker B687/693IVVDLAP
SITEY Cluster763/771YRQKYVSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQRNLTLHSTLPKAADDSDSFIDIDRLIAIVIRRAGSIALCVGAMVAVAVVYLLFSTSQYTSMTQILLDDSMTKYAQDQ
                    SFIDIDRLIAIVIRRAGSIALCVGAMVAVAVVYLLFSTSQYTSMTQILLDDSMTKYAQDQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPIANSQQVDMQIASAVEILKSNQLALRVVDAEKLQDNDTLLDPPQSPVALVKSGVKLIMSALLPGKPPANEDDERNGRR
PPIANSQQVDMQIASAVEILKSNQLALRVVDAEKLQDNDTLLDPPQSPVALVKSGVKLIMSALLPGKPPANEDDERNGRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKAASLLQDAVTVSRVNRSAVLAVSFRSTDRLLAARITKAYATAYLSDQLNANFDATESASVWLQQRLTDLRERSQQAAL
QKAASLLQDAVTVSRVNRSAVLAVSFRSTDRLLAARITKAYATA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVAKFKSDNGLTSANGELMSEQQLADLNKQLIVAQADAASTSARYNQFKSIVDLGPDSAVKNAAISSSQTDNTVIQDLRT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYISVSKREQEVTANFGEDHPQAVALRSEKQDLTNQIYQELQQLTASYRNEFEVARSREASLRQNIDHLTGKNSEADRSL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQLNDLEQRATALKTLYESYLGKYEEASQQQSFPIAKARVISEAGVPVSPSSPKKTMTLGLAIVLGLMAGGALTVFQEFR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERFFRVEGDVRTILGLKFLGYLPLVTKGPRENKIFRPRAQTPAKVVTPEPDNSDATFERIMRVVLEAPRSVFAETLRNAK


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASDVMFQGKSDRVIGVVSAMPGEGKSTTSANFAALLASSGKRTLLIDADLRNPGLTRMLKKPPQHGLVEAVLGEVPWAS
                 VSAMPGEGKSTTSANFAALLASSGKRTLLIDADLRNPGLTRMLKKPPQHGLVEAVLGEVPWAS
                        GKS                 LLIDADLR                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVKVDPVTKLAILPVLPNDHLMHTSELLASQGMFNLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDGFLFVTEWGATP
AVKVDPVTKLAILPVLPNDHLMHTSELLASQGMFNLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDGFLFVTEWGATP
                                              IVVDLAP                           
       730       740       750       760       770       780      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
TNVVRDLLNAEPQIKSKILGVILNKTDMTELGKFTNFGGAERYRQKYVSYYTDEAPKPRQPAEAGA
TNVVRDLLNAEPQIKSKILGVILNKTDMTELGKFTNFGGAERYRQKYVS                 
                                          YRQKYVSYY               

© 1998-2019