BYKdb

Annotate results for A0A1B9YJP6

A0A1B9YJP6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B9YJP6
DOMAINtad39/236GELHFRQIVGILRRRSALILTIAGTGTLLAIVVGLMIPPKYTAAAQLVIEAPVVRAERAQ
AALDEAVETHVTLLSSRDHLQRVIESLLQESDFRPLASDQAAPEPTSGDNRGASGSPVLD
QPANATAKETAGLNELRRRLNLWLGELRRTADTAVPRLEEFERNTKAIRERRSRVISIAF
TSTSAEKAATFANRIVQL
DOMAINcd441/635SSSIHGEGKTTLALSLASYIGILGRRVLLVDFDLRQGTARHGSNDPGSGLVEELLLKNRP
LTELIRRGGEARQDYLPIAAYRGDPLALFASEQMPNLIRQLRECYDCVIIDAPPVLGAIE
ARLLASMADKLLLVVKWGSTRRELAQNALSQLRGSGRFSRDRGDVAMAILTQVAPNKHAR
YRYGDVVNHKRYSSR
SITEWalker A448/450GKT
SITEWalker A'468/475LLVDFDLR
SITEWalker B548/554VIIDAPP
SITE-515/-521YLPIAAY
SITEY Cluster621/623YRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQVRLDEHAGDETARLDRVSTTEHKAIGSELSSTSPSGELHFRQIVGILRRRSALILTIAGTGTLLAIVVGLMIPPKYT
                                      GELHFRQIVGILRRRSALILTIAGTGTLLAIVVGLMIPPKYT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAQLVIEAPVVRAERAQAALDEAVETHVTLLSSRDHLQRVIESLLQESDFRPLASDQAAPEPTSGDNRGASGSPVLDQP
AAAQLVIEAPVVRAERAQAALDEAVETHVTLLSSRDHLQRVIESLLQESDFRPLASDQAAPEPTSGDNRGASGSPVLDQP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANATAKETAGLNELRRRLNLWLGELRRTADTAVPRLEEFERNTKAIRERRSRVISIAFTSTSAEKAATFANRIVQLYIDG
ANATAKETAGLNELRRRLNLWLGELRRTADTAVPRLEEFERNTKAIRERRSRVISIAFTSTSAEKAATFANRIVQL    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVQQKQASMTGEMAQLDERIAEAKSEMEAAGSAVQKALQQNARSTERTADGHLRELLRQAGNSAQHYDSLLRRQKEIRDQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QENVSSSVGIQLFAGVPNRPSSHNPILFIFPAFVLFAISGGWLAVLLEQLDRGLRSQQETADALGIPCIGLVPRLARRQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLPGQHLLTGRSSAYAEAIRSTVAALGLAAPTRSSKVVVVSSSIHGEGKTTLALSLASYIGILGRRVLLVDFDLRQGTAR
                                        SSSIHGEGKTTLALSLASYIGILGRRVLLVDFDLRQGTAR
                                               GKT                 LLVDFDLR     
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGSNDPGSGLVEELLLKNRPLTELIRRGGEARQDYLPIAAYRGDPLALFASEQMPNLIRQLRECYDCVIIDAPPVLGAIE
HGSNDPGSGLVEELLLKNRPLTELIRRGGEARQDYLPIAAYRGDPLALFASEQMPNLIRQLRECYDCVIIDAPPVLGAIE
                                                                   VIIDAPP      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARLLASMADKLLLVVKWGSTRRELAQNALSQLRGSGRFSRDRGDVAMAILTQVAPNKHARYRYGDVVNHKRYSSRSIESR
ARLLASMADKLLLVVKWGSTRRELAQNALSQLRGSGRFSRDRGDVAMAILTQVAPNKHARYRYGDVVNHKRYSSR     
                                                            YRY                 
       650       660       670       680 
....:....|....:....|....:....|....:....|.
LGPDGPRKRVTKHASQLDPPPTRSSQCAKVKNSKSGKPAGR


© 1998-2019