BYKdb

Annotate results for A0A1B9Z4G0

A0A1B9Z4G0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1B9Z4G0
DOMAINtad27/205PTVDLREMGRILRRRYKLVVLPVAVLLGLALTYLTLTTTLYTATSTVLVDPRRANVVETN
QSVLSNFGTDDATIESQTLLIQSVAILVRVVGKLKLTEDAEFKPKPGLLDPIRRLFSMFS
GSGPSDGASAEDAARARSVEILQRRMKVTRQGTTFLVDIAVNSESPQKAATIANAVADA
DOMAINcd574/764TSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRSLCPRADAGLLEVAIGHVA
PERAVLVDQSTGLSVLPSTRIKQVEFITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPL
VDGRALAELADRIILALAWDQTPREVLSHAMDLLSPVGDRIMGTVLTRVDLSRLQFYDYY
RSSAYLKPYGT
SITEWalker A581/583GKT
SITEWalker A'601/608LLIDGDLR
SITEWalker B683/689IVIDSPP
SITE-675/-680YFRHRY
SITEY Cluster750/762YDYYRSSAYLKPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQRNSDLPYVVPDEPPVRPAESWQYPTVDLREMGRILRRRYKLVVLPVAVLLGLALTYLTLTTTLYTATSTVLVDPRRA
                          PTVDLREMGRILRRRYKLVVLPVAVLLGLALTYLTLTTTLYTATSTVLVDPRRA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVVETNQSVLSNFGTDDATIESQTLLIQSVAILVRVVGKLKLTEDAEFKPKPGLLDPIRRLFSMFSGSGPSDGASAEDAA
NVVETNQSVLSNFGTDDATIESQTLLIQSVAILVRVVGKLKLTEDAEFKPKPGLLDPIRRLFSMFSGSGPSDGASAEDAA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RARSVEILQRRMKVTRQGTTFLVDIAVNSESPQKAATIANAVADAYFDEQVRAKHDATRIAANWLNGQIDELKSRVVASE
RARSVEILQRRMKVTRQGTTFLVDIAVNSESPQKAATIANAVADA                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KAVEDYRSANNLMVSQGVTLNDQQLTDLNNKLIAARVQTAEARAKYEQVQDIAKSGGDPGGINAAISSEMITKLRTQYAD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAKNEADLSSKYGARHPLVANVRAQRRDTQKLINDEIRRILESTKHDYDVARSREVSLQQNLDQLQGVSTSSGQAQVRLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELQREAEASRTLYESYLARSKETTAQESLEMPDSRIVTKASIPIRPSSPKTMLILGLALMLGLGAGSVLAFLTDYLDGRV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTLEQAESIAGVPALAAVPLIGTRELARLARRGRSELDSYDPKTTKLLPPALQPPLTRYAIDEPGTFFAEAIRAVRLSLQ


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTMRSQPVKVVQVTSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRSLCPRADAGLLEVAIGHVAPERAVLV
             TSALDSEGKTTLAINLAQSLATLGIRTLLIDGDLRNPQVTRSLCPRADAGLLEVAIGHVAPERAVLV
                    GKT                 LLIDGDLR                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQSTGLSVLPSTRIKQVEFITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPLVDGRALAELADRIILALAWDQTPREVL
DQSTGLSVLPSTRIKQVEFITELMFSDRIVDVLDYFRHRYELIVIDSPPLVPLVDGRALAELADRIILALAWDQTPREVL
                                          IVIDSPP                               
       730       740       750       760       770   
....:....|....:....|....:....|....:....|....:....|...
SHAMDLLSPVGDRIMGTVLTRVDLSRLQFYDYYRSSAYLKPYGTAGLHAGAAR
SHAMDLLSPVGDRIMGTVLTRVDLSRLQFYDYYRSSAYLKPYGT         
                             YDYYRSSAYLKPY           

© 1998-2019