BYKdb

Annotate results for A0A1C0A6S9

A0A1C0A6S9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0A6S9
DOMAINcd37/224TSSGPSEGKSLTIANLAVSMAQNGKKVVIIDADMRKPMQHKFYDLPNFEGLSNILTSEIE
FEDGLRETGIDGLKVVTTGTVPPNPAELLNSKRMEEVIKKAEKEADMVFIDTPPVIAVTD
AAVLSNKVDGIILIVASHQTEEQMMVRAKENLDKANANIIGTIITKYPVSTKGGYYNYYY
YYGNSFKG
SITEWalker A44/46GKS
SITEWalker A'64/71VIIDADMR
SITEWalker B144/150VFIDTPP
SITEY Cluster211/218YYNYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIVKHNPKSPASEAYRSIRTNISFLSPDNPLTKIAVTSSGPSEGKSLTIANLAVSMAQNGKKVVIIDADMRKPMQHKFYD
                                    TSSGPSEGKSLTIANLAVSMAQNGKKVVIIDADMRKPMQHKFYD
                                           GKS                 VIIDADMR         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPNFEGLSNILTSEIEFEDGLRETGIDGLKVVTTGTVPPNPAELLNSKRMEEVIKKAEKEADMVFIDTPPVIAVTDAAVL
LPNFEGLSNILTSEIEFEDGLRETGIDGLKVVTTGTVPPNPAELLNSKRMEEVIKKAEKEADMVFIDTPPVIAVTDAAVL
                                                               VFIDTPP          
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
SNKVDGIILIVASHQTEEQMMVRAKENLDKANANIIGTIITKYPVSTKGGYYNYYYYYGNSFKG
SNKVDGIILIVASHQTEEQMMVRAKENLDKANANIIGTIITKYPVSTKGGYYNYYYYYGNSFKG
                                                  YYNYYYYY      
© 1998-2019